PREB

Матеріал з Вікіпедії — вільної енциклопедії.
Перейти до навігації Перейти до пошуку
PREB
Ідентифікатори
Символи PREB, SEC12, prolactin regulatory element binding
Зовнішні ІД OMIM: 606395 MGI: 1355326 HomoloGene: 40877 GeneCards: PREB
Шаблон експресії
PBB GE PREB 217861 s at fs.png
Більше даних
Ортологи
Види Людина Миша
Entrez
Ensembl
UniProt
RefSeq (мРНК)
NM_001330484
NM_001330485
NM_001330486
NM_001330487
NM_013388
NM_001294302
NM_016703
RefSeq (білок)
NP_001317413
NP_001317414
NP_001317415
NP_001317416
NP_037520
NP_001281231
NP_057912
Локус (UCSC) Хр. 2: 27.13 – 27.13 Mb Хр. 5: 30.95 – 30.96 Mb
PubMed search [1] [2]
Вікідані
Див./Ред. для людейДив./Ред. для мишей

PREB (англ. Prolactin regulatory element binding) – білок, який кодується однойменним геном, розташованим у людей на короткому плечі 2-ї хромосоми. [3] Довжина поліпептидного ланцюга білка становить 417 амінокислот, а молекулярна маса — 45 468[4].

Послідовність амінокислот
1020304050
MGRRRAPELYRAPFPLYALQVDPSTGLLIAAGGGGAAKTGIKNGVHFLQL
ELINGRLSASLLHSHDTETRATMNLALAGDILAAGQDAHCQLLRFQAHQQ
QGNKAEKAGSKEQGPRQRKGAAPAEKKCGAETQHEGLELRVENLQAVQTD
FSSDPLQKVVCFNHDNTLLATGGTDGYVRVWKVPSLEKVLEFKAHEGEIE
DLALGPDGKLVTVGRDLKASVWQKDQLVTQLHWQENGPTFSSTPYRYQAC
RFGQVPDQPAGLRLFTVQIPHKRLRQPPPCYLTAWDGSNFLPLRTKSCGH
EVVSCLDVSESGTFLGLGTVTGSVAIYIAFSLQCLYYVREAHGIVVTDVA
FLPEKGRGPELLGSHETALFSVAVDSRCQLHLLPSRRSVPVWLLLLLCVG
LIIVTILLLQSAFPGFL

Кодований геном білок за функцією належить до активаторів. Задіяний у таких біологічних процесах як транскрипція, регуляція транскрипції, транспорт, транспорт білків, транспорт між ендоплазматичним ретикулумом і апаратом Гольджі. Білок має сайт для зв'язування з ДНК. Локалізований у ядрі, мембрані, ендоплазматичному ретикулумі.

Література[ред. | ред. код]

  • Edgar A.J. (2003). The gene structure and expression of human ABHD1: overlapping polyadenylation signal sequence with Sec12.. BMC Genomics 4: 18 — 18.  PubMed DOI:10.1186/1471-2164-4-18
  • The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).. Genome Res. 14: 2121 — 2127. 2004.  PubMed DOI:10.1101/gr.2596504
  • Tanabe T., Maeda M., Saito K., Katada T. (2016). Dual function of cTAGE5 in collagen export from the endoplasmic reticulum.. Mol. Biol. Cell 27: 2008 — 2013.  PubMed DOI:10.1091/mbc.E16-03-0180

Примітки[ред. | ред. код]

  1. Human PubMed Reference:. 
  2. Mouse PubMed Reference:. 
  3. HUGO Gene Nomenclature Commitee, HGNC:9356 (англ.). Архів оригіналу за 20 квітня 2017. Процитовано 28 серпня 2017. 
  4. UniProt, Q9HCU5 (англ.). Архів оригіналу за 15 грудня 2017. Процитовано 28 серпня 2017. 

Див. також[ред. | ред. код]