ARHGAP45

Матеріал з Вікіпедії — вільної енциклопедії.
Перейти до навігації Перейти до пошуку
ARHGAP45
Наявні структури
PDBПошук ортологів: PDBe RCSB
Ідентифікатори
Символи ARHGAP45, HA-1, HLA-HA1, HMHA1, histocompatibility (minor) HA-1, Rho GTPase activating protein 45
Зовнішні ІД OMIM: 601155 MGI: 1917969 HomoloGene: 69120 GeneCards: ARHGAP45
Шаблон експресії
PBB GE HMHA1 217614 at fs.png

PBB GE HMHA1 212873 at fs.png
Більше даних
Ортологи
Види Людина Миша
Entrez
Ensembl
UniProt
RefSeq (мРНК)
NM_001258328
NM_001282334
NM_001282335
NM_012292
NM_001321232
NM_001142701
NM_027521
NM_001347074
RefSeq (білок)
NP_001245257
NP_001269263
NP_001269264
NP_001308161
NP_036424
NP_001136173
NP_001334003
NP_081797
Локус (UCSC) Хр. 19: 1.07 – 1.09 Mb Хр. 10: 79.85 – 79.87 Mb
PubMed search [1] [2]
Вікідані
Див./Ред. для людейДив./Ред. для мишей

ARHGAP45 (англ. Rho GTPase activating protein 45) – білок, який кодується однойменним геном, розташованим у людей на короткому плечі 19-ї хромосоми.[3] Довжина поліпептидного ланцюга білка становить 1 136 амінокислот, а молекулярна маса — 124 614[4].

Послідовність амінокислот
1020304050
MFSRKKRELMKTPSISKKNRAGSPSPQPSGELPRKDGADAVFPGPSLEPP
AGSSGVKATGTLKRPTSLSRHASAAGFPLSGAASWTLGRSHRSPLTAASP
GELPTEGAGPDVVEDISHLLADVARFAEGLEKLKECVLRDDLLEARRPRA
HECLGEALRVMHQIISKYPLLNTVETLTAAGTLIAKVKAFHYESNNDLEK
QEFEKALETIAVAFSSTVSEFLMGEVDSSTLLAVPPGDSSQSMESLYGPG
SEGTPPSLEDCDAGCLPAEEVDVLLQRCEGGVDAALLYAKNMAKYMKDLI
SYLEKRTTLEMEFAKGLQKIAHNCRQSVMQEPHMPLLSIYSLALEQDLEF
GHSMVQAVGTLQTQTFMQPLTLRRLEHEKRRKEIKEAWHRAQRKLQEAES
NLRKAKQGYVQRCEDHDKARFLVAKAEEEQAGSAPGAGSTATKTLDKRRR
LEEEAKNKAEEAMATYRTCVADAKTQKQELEDTKVTALRQIQEVIRQSDQ
TIKSATISYYQMMHMQTAPLPVHFQMLCESSKLYDPGQQYASHVRQLQRD
QEPDVHYDFEPHVSANAWSPVMRARKSSFNVSDVARPEAAGSPPEEGGCT
EGTPAKDHRAGRGHQVHKSWPLSISDSDSGLDPGPGAGDFKKFERTSSSG
TMSSTEELVDPDGGAGASAFEQADLNGMTPELPVAVPSGPFRHEGLSKAA
RTHRLRKLRTPAKCRECNSYVYFQGAECEECCLACHKKCLETLAIQCGHK
KLQGRLQLFGQDFSHAARSAPDGVPFIVKKCVCEIERRALRTKGIYRVNG
VKTRVEKLCQAFENGKELVELSQASPHDISNVLKLYLRQLPEPLISFRLY
HELVGLAKDSLKAEAEAKAASRGRQDGSESEAVAVALAGRLRELLRDLPP
ENRASLQYLLRHLRRIVEVEQDNKMTPGNLGIVFGPTLLRPRPTEATVSL
SSLVDYPHQARVIETLIVHYGLVFEEEPEETPGGQDESSNQRAEVVVQVP
YLEAGEAVVYPLQEAAADGCRESRVVSNDSDSDLEEASELLSSSEASALG
HLSFLEQQQSEASLEVASGSHSGSEEQLEATAREDGDGDEDGPAQQLSGF
NTNQSNNVLQAPLPPMRLRGGRMTLGSCRERQPEFV

Кодований геном білок за функціями належить до активаторів гтфаз, фосфопротеїнів. Задіяний у такому біологічному процесі, як альтернативний сплайсинг. Білок має сайт для зв'язування з іонами металів, іоном цинку. Локалізований у клітинній мембрані, цитоплазмі, мембрані, клітинних відростках.

Література[ред. | ред. код]

  • Kaminski W.E., Piehler A., Schmitz G. (2000). Genomic organization of the human cholesterol-responsive ABC transporter ABCA7: tandem linkage with the minor histocompatibility antigen HA-1 gene.. Biochem. Biophys. Res. Commun. 278: 782 — 789.  PubMed DOI:10.1006/bbrc.2000.3880
  • The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).. Genome Res. 14: 2121 — 2127. 2004.  PubMed DOI:10.1101/gr.2596504
  • Graziano C., Giorgi M., Malentacchi C., Mattiuz P.L., Porfirio B. (2005). Sequence diversity within the HA-1 gene as detected by melting temperature assay without oligonucleotide probes.. BMC Med. Genet. 6: 36 — 36.  PubMed DOI:10.1186/1471-2350-6-36
  • van Lochem E., van der Keur M., Mommaas A.M., de Gast G.C., Goulmy E. (1996). Functional expression of minor histocompatibility antigens on human peripheral blood dendritic cells and epidermal Langerhans cells.. Transpl. Immunol. 4: 151 — 157.  PubMed DOI:10.1016/S0966-3274(96)80009-8
  • Beausoleil S.A., Villen J., Gerber S.A., Rush J., Gygi S.P. (2006). A probability-based approach for high-throughput protein phosphorylation analysis and site localization.. Nat. Biotechnol. 24: 1285 — 1292.  PubMed DOI:10.1038/nbt1240
  • Carrascal M., Ovelleiro D., Casas V., Gay M., Abian J. (2008). Phosphorylation analysis of primary human T lymphocytes using sequential IMAC and titanium oxide enrichment.. J. Proteome Res. 7: 5167 — 5176.  PubMed DOI:10.1021/pr800500r

Примітки[ред. | ред. код]

  1. Human PubMed Reference:. 
  2. Mouse PubMed Reference:. 
  3. HUGO Gene Nomenclature Commitee, HGNC:17102 (англ.). Архів оригіналу за 10 вересня 2015. Процитовано 12 вересня 2017. 
  4. UniProt, Q92619 (англ.). Архів оригіналу за 27 вересня 2017. Процитовано 12 вересня 2017. 

Див. також[ред. | ред. код]