PTPRT

Матеріал з Вікіпедії — вільної енциклопедії.
Перейти до навігації Перейти до пошуку
PTPRT
Protein PTPRT PDB 2ooq.png
Наявні структури
PDBПошук ортологів: PDBe RCSB
Ідентифікатори
Символи PTPRT, RPTPrho, protein tyrosine phosphatase, receptor type T, protein tyrosine phosphatase receptor type T, RPTP-rho, R-PTP-T
Зовнішні ІД OMIM: 608712 MGI: 1321152 HomoloGene: 56924 GeneCards: PTPRT
Пов'язані генетичні захворювання
періодонтит[1]
Шаблон експресії
PBB GE PTPRT 205948 at fs.png
Більше даних
Ортологи
Види Людина Миша
Entrez
Ensembl
UniProt
RefSeq (мРНК)
NM_007050
NM_133170
NM_001394024
NM_001394025
NM_001394026
NM_001291149
NM_001291150
NM_001291151
NM_021464
RefSeq (білок)
NP_008981
NP_573400
NP_001278078
NP_001278079
NP_001278080
NP_067439
Локус (UCSC) Хр. 20: 42.07 – 43.19 Mb Хр. 2: 161.36 – 162.5 Mb
PubMed search [2] [3]
Вікідані
Див./Ред. для людейДив./Ред. для мишей

PTPRT (англ. Protein tyrosine phosphatase, receptor type T) – білок, який кодується однойменним геном, розташованим у людей на короткому плечі 20-ї хромосоми.[4] Довжина поліпептидного ланцюга білка становить 1 441 амінокислот, а молекулярна маса — 162 134[5].

Послідовність амінокислот
1020304050
MASLAALALSLLLRLQLPPLPGARAQSAAGGCSFDEHYSNCGYSVALGTN
GFTWEQINTWEKPMLDQAVPTGSFMMVNSSGRASGQKAHLLLPTLKENDT
HCIDFHYYFSSRDRSSPGALNVYVKVNGGPQGNPVWNVSGVVTEGWVKAE
LAISTFWPHFYQVIFESVSLKGHPGYIAVDEVRVLAHPCRKAPHFLRLQN
VEVNVGQNATFQCIAGGKWSQHDKLWLQQWNGRDTALMVTRVVNHRRFSA
TVSVADTAQRSVSKYRCVIRSDGGSGVSNYAELIVKEPPTPIAPPELLAV
GATYLWIKPNANSIIGDGPIILKEVEYRTTTGTWAETHIVDSPNYKLWHL
DPDVEYEIRVLLTRPGEGGTGPPGPPLTTRTKCADPVHGPQNVEIVDIRA
RQLTLQWEPFGYAVTRCHSYNLTVQYQYVFNQQQYEAEEVIQTSSHYTLR
GLRPFMTIRLRLLLSNPEGRMESEELVVQTEEDVPGAVPLESIQGGPFEE
KIYIQWKPPNETNGVITLYEINYKAVGSLDPSADLSSQRGKVFKLRNETH
HLFVGLYPGTTYSFTIKASTAKGFGPPVTTRIATKISAPSMPEYDTDTPL
NETDTTITVMLKPAQSRGAPVSVYQLVVKEERLQKSRRAADIIECFSVPV
SYRNASSLDSLHYFAAELKPANLPVTQPFTVGDNKTYNGYWNPPLSPLKS
YSIYFQALSKANGETKINCVRLATKGASTQNSNTVEPEKQVDNTVKMAGV
IAGLLMFIIILLGVMLTIKRRRNAYSYSYYLKLAKKQKETQSGAQREMGP
VASADKPTTKLSASRNDEGFSSSSQDVNGFTDGSRGELSQPTLTIQTHPY
RTCDPVEMSYPRDQFQPAIRVADLLQHITQMKRGQGYGFKEEYEALPEGQ
TASWDTAKEDENRNKNRYGNIISYDHSRVRLLVLDGDPHSDYINANYIDG
YHRPRHYIATQGPMQETVKDFWRMIWQENSASIVMVTNLVEVGRVKCVRY
WPDDTEVYGDIKVTLIETEPLAEYVIRTFTVQKKGYHEIRELRLFHFTSW
PDHGVPCYATGLLGFVRQVKFLNPPEAGPIVVHCSAGAGRTGCFIAIDTM
LDMAENEGVVDIFNCVRELRAQRVNLVQTEEQYVFVHDAILEACLCGNTA
IPVCEFRSLYYNISRLDPQTNSSQIKDEFQTLNIVTPRVRPEDCSIGLLP
RNHDKNRSMDVLPLDRCLPFLISVDGESSNYINAALMDSHKQPAAFVVTQ
HPLPNTVADFWRLVFDYNCSSVVMLNEMDTAQFCMQYWPEKTSGCYGPIQ
VEFVSADIDEDIIHRIFRICNMARPQDGYRIVQHLQYIGWPAYRDTPPSK
RSLLKVVRRLEKWQEQYDGREGRTVVHCLNGGGRSGTFCAICSVCEMIQQ
QNIIDVFHIVKTLRNNKSNMVETLEQYKFVYEVALEYLSSF

Кодований геном білок за функціями належить до гідролаз, рецепторів, протеїн-фосфатаз, фосфопротеїнів. Задіяний у такому біологічному процесі, як альтернативний сплайсинг. Локалізований у мембрані.

Література[ред. | ред. код]

Примітки[ред. | ред. код]

Див. також[ред. | ред. код]