PIR

Матеріал з Вікіпедії — вільної енциклопедії.
Перейти до навігації Перейти до пошуку
PIR
Protein PIR PDB 1j1l.png
Наявні структури
PDBПошук ортологів: PDBe RCSB
Ідентифікатори
Символи PIR, pirin
Зовнішні ІД OMIM: 300931 MGI: 1916906 HomoloGene: 2717 GeneCards: PIR
Шаблон експресії
PBB GE PIR 207469 s at fs.png
Більше даних
Ортологи
Види Людина Миша
Entrez
Ensembl
UniProt
RefSeq (мРНК)
NM_003662
NM_001018109
NM_001301402
NM_027153
RefSeq (білок)
NP_001018119
NP_003653
NP_001288331
NP_081429
Локус (UCSC) Хр. X: 15.38 – 15.49 Mb Хр. X: 163.05 – 163.16 Mb
PubMed search [1] [2]
Вікідані
Див./Ред. для людейДив./Ред. для мишей

PIR (англ. Pirin) – білок, який кодується однойменним геном, розташованим у людей на X-хромосомі.[3] Довжина поліпептидного ланцюга білка становить 290 амінокислот, а молекулярна маса — 32 113[4].

Послідовність амінокислот
1020304050
MGSSKKVTLSVLSREQSEGVGARVRRSIGRPELKNLDPFLLFDEFKGGRP
GGFPDHPHRGFETVSYLLEGGSMAHEDFCGHTGKMNPGDLQWMTAGRGIL
HAEMPCSEEPAHGLQLWVNLRSSEKMVEPQYQELKSEEIPKPSKDGVTVA
VISGEALGIKSKVYTRTPTLYLDFKLDPGAKHSQPIPKGWTSFIYTISGD
VYIGPDDAQQKIEPHHTAVLGEGDSVQVENKDPKRSHFVLIAGEPLREPV
IQHGPFVMNTNEEISQAILDFRNAKNGFERAKTWKSKIGN

Кодований геном білок за функцією належить до оксидоредуктаз. Задіяний у таких біологічних процесах, як транскрипція, регуляція транскрипції. Білок має сайт для зв'язування з іонами металів, іоном заліза. Локалізований у цитоплазмі, ядрі.

Література[ред. | ред. код]

  • Wendler W.M.F., Kremmer E., Foerster R., Winnacker E.-L. (1997). Identification of pirin, a novel highly conserved nuclear protein.. J. Biol. Chem. 272: 8482 — 8489.  PubMed DOI:10.1074/jbc.272.13.8482
  • The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).. Genome Res. 14: 2121 — 2127. 2004.  PubMed DOI:10.1101/gr.2596504
  • Adams M., Jia Z. (2005). Structural and biochemical analysis reveal pirins to possess quercetinase activity.. J. Biol. Chem. 280: 28675 — 28682.  PubMed DOI:10.1074/jbc.M501034200
  • Gelbman B.D., Heguy A., O'Connor T.P., Zabner J., Crystal R.G. (2007). Upregulation of pirin expression by chronic cigarette smoking is associated with bronchial epithelial cell apoptosis.. Respir. Res. 8: 10 — 10.  PubMed DOI:10.1186/1465-9921-8-10
  • Licciulli S., Cambiaghi V., Scafetta G., Gruszka A.M., Alcalay M. (2010). Pirin downregulation is a feature of AML and leads to impairment of terminal myeloid differentiation.. Leukemia 24: 429 — 437.  PubMed DOI:10.1038/leu.2009.247
  • Miyazaki I., Simizu S., Okumura H., Takagi S., Osada H. (2010). A small-molecule inhibitor shows that pirin regulates migration of melanoma cells.. Nat. Chem. Biol. 6: 667 — 673.  PubMed DOI:10.1038/nchembio.423

Примітки[ред. | ред. код]

  1. Human PubMed Reference:. 
  2. Mouse PubMed Reference:. 
  3. HUGO Gene Nomenclature Commitee, HGNC:30048 (англ.). Процитовано 13 вересня 2017. 
  4. UniProt, O00625 (англ.). Архів оригіналу за 6 вересня 2017. Процитовано 13 вересня 2017. 

Див. також[ред. | ред. код]