Відмінності між версіями «ALDH1A1»

Матеріал з Вікіпедії — вільної енциклопедії.
Перейти до навігації Перейти до пошуку
[перевірена версія][перевірена версія]
м (Розвікіфікація послідовності амінокислот)
Рядок 64: Рядок 64:
 
* [[Хромосома 9 (людина)|Хромосома 9]]
 
* [[Хромосома 9 (людина)|Хромосома 9]]
 
{{protein-stub}}
 
{{protein-stub}}
[[Категорія:Некатегоризовані білки]]
+
[[Категорія:Оксидоредуктази]]

Версія за 14:12, 15 лютого 2020

ALDH1A1
PDB 1bxs EBI.jpg
Наявні структури
PDBПошук ортологів: PDBe RCSB
Ідентифікатори
Символи ALDH1A1, ALDC, ALDH-E1, ALDH1, ALDH11, HEL-9, HEL-S-53e, HEL12, PUMB1, RALDH1, aldehyde dehydrogenase 1 family member A1
Зовнішні ІД OMIM: 100640 MGI: 1353450 HomoloGene: 110441 GeneCards: ALDH1A1
Ортологи
Види Людина Миша
Entrez
Ensembl
UniProt
RefSeq (мРНК)
NM_000689
NM_013467
RefSeq (білок)
NP_000680
NP_038495
NP_001348432
NP_001348433
NP_001348434
NP_001348435
Локус (UCSC) Хр. 9: 72.9 – 73.08 Mb Хр. 19: 20.49 – 20.64 Mb
PubMed search [1] [2]
Вікідані
Див./Ред. для людейДив./Ред. для мишей

ALDH1A1 (англ. Aldehyde dehydrogenase 1 family member A1) – білок, який кодується однойменним геном, розташованим у людей на короткому плечі 9-ї хромосоми.[3] Довжина поліпептидного ланцюга білка становить 501 амінокислот, а молекулярна маса — 54 862[4].

Послідовність амінокислот
1020304050
MSSSGTPDLPVLLTDLKIQYTKIFINNEWHDSVSGKKFPVFNPATEEELC
QVEEGDKEDVDKAVKAARQAFQIGSPWRTMDASERGRLLYKLADLIERDR
LLLATMESMNGGKLYSNAYLNDLAGCIKTLRYCAGWADKIQGRTIPIDGN
FFTYTRHEPIGVCGQIIPWNFPLVMLIWKIGPALSCGNTVVVKPAEQTPL
TALHVASLIKEAGFPPGVVNIVPGYGPTAGAAISSHMDIDKVAFTGSTEV
GKLIKEAAGKSNLKRVTLELGGKSPCIVLADADLDNAVEFAHHGVFYHQG
QCCIAASRIFVEESIYDEFVRRSVERAKKYILGNPLTPGVTQGPQIDKEQ
YDKILDLIESGKKEGAKLECGGGPWGNKGYFVQPTVFSNVTDEMRIAKEE
IFGPVQQIMKFKSLDDVIKRANNTFYGLSAGVFTKDIDKAITISSALQAG
TVWVNCYGVVSAQCPFGGFKMSGNGRELGEYGFHEYTEVKTVTVKISQKN
S

Кодований геном білок за функціями належить до оксидоредуктаз, фосфопротеїнів. Задіяний у такому біологічному процесі, як ацетилювання. Білок має сайт для зв'язування з нуклеотидами, НАД. Локалізований у цитоплазмі.

Література

  • Hsu L.C., Chang W.-C., Yoshida A. (1989). Genomic structure of the human cytosolic aldehyde dehydrogenase gene.. Genomics 5: 857 — 865.  PubMed DOI:10.1016/0888-7543(89)90127-4
  • Zheng C.F., Wang T.T., Weiner H. (1993). Cloning and expression of the full-length cDNAs encoding human liver class 1 and class 2 aldehyde dehydrogenase.. Alcohol. Clin. Exp. Res. 17: 828 — 831.  PubMed DOI:10.1111/j.1530-0277.1993.tb00849.x
  • The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).. Genome Res. 14: 2121 — 2127. 2004.  PubMed DOI:10.1101/gr.2596504
  • Hempel J., von Bahr-Lindstroem H., Joernvall H. (1984). Aldehyde dehydrogenase from human liver. Primary structure of the cytoplasmic isoenzyme.. Eur. J. Biochem. 141: 21 — 35.  PubMed DOI:10.1111/j.1432-1033.1984.tb08150.x
  • Yoshida A., Ikawa M., Hsu L.C., Tani K. (1985). Molecular abnormality and cDNA cloning of human aldehyde dehydrogenases.. Alcohol 2: 103 — 106.  PubMed DOI:10.1016/0741-8329(85)90024-2
  • Hsu L.C., Tani K., Fujiyoshi T., Kurachi K., Yoshida A. (1985). Cloning of cDNAs for human aldehyde dehydrogenases 1 and 2.. Proc. Natl. Acad. Sci. U.S.A. 82: 3771 — 3775.  PubMed DOI:10.1073/pnas.82.11.3771

Примітки

  1. Human PubMed Reference:. 
  2. Mouse PubMed Reference:. 
  3. HUGO Gene Nomenclature Commitee, HGNC:402 (англ.). Процитовано 8 вересня 2017. 
  4. UniProt, P00352 (англ.). Процитовано 8 вересня 2017. 

Див. також