Відмінності між версіями «CREBBP»

Матеріал з Вікіпедії — вільної енциклопедії.
Перейти до навігації Перейти до пошуку
[перевірена версія][перевірена версія]
(вікіфікація)
Рядок 105: Рядок 105:
 
Величезна кількість експериментальних даних свідчать про ключову роль ацетилювання гістонів у пластичності [[синапс]]ів у [[ссавці]]в (зокрема [[Довготривала потенціація|довготривалої потенціації]]), [[Пам'ять|пам'яті]] та поведінкової адаптації до навколишнього середовища. Початкові свідоцтва пов'язані зі спостереженням, що стосуються хворих [[Синдром Рубінштейна - Тейбі|синдромом Рубінштейна&nbsp;— Тейбі]]: у них [[мутації]], що зачіпають CBP, призводять до розумової відсталості. Крім того, миші, мутантні за ''CREBBP'', мали порушення [[Молекулярні та клітинні механізми пам'яті|довготривалої пам'яті]]<ref>{{cite pmid|21673711}}</ref>. Подальші експерименти показали, що CBP важливий не для для нейронної пластичності, але й для виживання [[нейрон]]ів, пов'язаного з їхньою активністю<ref>{{cite pmid|12909086}}</ref>, і [[нейрогенез]]ом<ref>{{cite pmid|21847097}}</ref>.
 
Величезна кількість експериментальних даних свідчать про ключову роль ацетилювання гістонів у пластичності [[синапс]]ів у [[ссавці]]в (зокрема [[Довготривала потенціація|довготривалої потенціації]]), [[Пам'ять|пам'яті]] та поведінкової адаптації до навколишнього середовища. Початкові свідоцтва пов'язані зі спостереженням, що стосуються хворих [[Синдром Рубінштейна - Тейбі|синдромом Рубінштейна&nbsp;— Тейбі]]: у них [[мутації]], що зачіпають CBP, призводять до розумової відсталості. Крім того, миші, мутантні за ''CREBBP'', мали порушення [[Молекулярні та клітинні механізми пам'яті|довготривалої пам'яті]]<ref>{{cite pmid|21673711}}</ref>. Подальші експерименти показали, що CBP важливий не для для нейронної пластичності, але й для виживання [[нейрон]]ів, пов'язаного з їхньою активністю<ref>{{cite pmid|12909086}}</ref>, і [[нейрогенез]]ом<ref>{{cite pmid|21847097}}</ref>.
   
Порушення з боку імунної системи, які проявляються у пацієнтів з синдромом Рубінштейна&nbsp;— Тейбі, свідчать про важливу роль CBP у функціонуванні [[Імунна система|імунної системи]] і [[Запалення|запальних процесах]]. Ймовірно, цей ефект обумовлений ненормально зниженою експресією таких важливих для імунітету білків, як CREB, NF-κB, c-jun, [[FOS|c-Fos]], [[BCL2]] і [[Myc|c-Myc]], обумовленою відсутністю активності CBP<ref>{{cite pmid|23643710}}</ref>. Справді, регулюючи активність транскрипційних факторів NF-κB і {{нп|Транскрипційний фактор AP-1|AP-1||en|AP-1 transcription factor}}, які активують гени, пов'язані з хронічним і гострим запаленням, CBP може відігравати важливу роль у контролі запалення на рівні транскрипції<ref>{{cite pmid|12168567}}</ref>. Встановлено, що CBP задіяний в експресії білка [[CD59]], який бере участь у захисті клітин організму від атак з боку [[Система комплементу|системи комплементу]]<ref>{{cite pmid|24338025}}</ref>.
+
Порушення з боку імунної системи, які проявляються у пацієнтів з синдромом Рубінштейна&nbsp;— Тейбі, свідчать про важливу роль CBP у функціонуванні [[Імунна система|імунної системи]] і [[Запалення|запальних процесах]]. Ймовірно, цей ефект обумовлений ненормально зниженою експресією таких важливих для імунітету білків, як CREB, NF-κB, c-jun, [[FOS|c-Fos]], [[BCL2]] і [[Myc|c-Myc]], обумовленою відсутністю активності CBP<ref>{{cite pmid|23643710}}</ref>. Справді, регулюючи активність транскрипційних факторів NF-κB і {{нп|Транскрипційний фактор AP-1|AP-1|en|AP-1 transcription factor}}, які активують гени, пов'язані з хронічним і гострим запаленням, CBP може відігравати важливу роль у контролі запалення на рівні транскрипції<ref>{{cite pmid|12168567}}</ref>. Встановлено, що CBP задіяний в експресії білка [[CD59]], який бере участь у захисті клітин організму від атак з боку [[Система комплементу|системи комплементу]]<ref>{{cite pmid|24338025}}</ref>.
   
 
CBP відіграє важливу роль у функціонуванні [[Жіноча репродуктивна система|жіночої репродуктивної системи]]. На мишах показано, що він необхідний для експресії [[LHB|лютеїнізуючого гормону-бета]] і підтримки нормальної [[Фертильність|фертильності]]<ref>{{cite pmid|22508984}}</ref>. Крім того, CBP необхідний для експресії генів-мішеней [[Лютеїнізуючий гормон|лютеїнізуючого гормону]] під час [[Овуляція|овуляції]]<ref>{{cite pmid|24878634}}</ref>. Він також бере участь у клітинній відповіді на зв'язування [[естроген]]у<ref>{{cite pmid|22083956}}</ref>.
 
CBP відіграє важливу роль у функціонуванні [[Жіноча репродуктивна система|жіночої репродуктивної системи]]. На мишах показано, що він необхідний для експресії [[LHB|лютеїнізуючого гормону-бета]] і підтримки нормальної [[Фертильність|фертильності]]<ref>{{cite pmid|22508984}}</ref>. Крім того, CBP необхідний для експресії генів-мішеней [[Лютеїнізуючий гормон|лютеїнізуючого гормону]] під час [[Овуляція|овуляції]]<ref>{{cite pmid|24878634}}</ref>. Він також бере участь у клітинній відповіді на зв'язування [[естроген]]у<ref>{{cite pmid|22083956}}</ref>.

Версія за 10:49, 20 жовтня 2017

CREBBP
Protein CREBBP PDB 1f81.png
Наявні структури
PDBПошук ортологів: PDBe RCSB
Ідентифікатори
Символи CREBBP, AW558298, CBP, CBP/p300, KAT3A, p300/CBP, RSTS, CREB binding protein, RSTS1
Зовнішні ІД MGI: 1098280 HomoloGene: 68393 GeneCards: CREBBP
Пов'язані генетичні захворювання
Ожиріння[1]
Шаблон експресії
PBB GE CREBBP 211808 s at fs.png

PBB GE CREBBP 202160 at fs.png
Більше даних
Ортологи
Види Людина Миша
Entrez
Ensembl
UniProt
RefSeq (мРНК)
NM_001079846
NM_004380
NM_001025432
RefSeq (білок)
NP_001073315
NP_004371
н/д
Локус (UCSC) Хр. 16: 3.73 – 3.88 Mb Хр. 16: 4.08 – 4.21 Mb
PubMed search [2] [3]
Вікідані
Див./Ред. для людейДив./Ред. для мишей

CREBBP (англ. cyclic AMP response element binding protein), CREB-зв'язувальний білок (англ. CREB binding protein) — білок, який кодується однойменним геном, розташованим у людей на короткому плечі 16-ї хромосоми.[4] CREBBP (як і його близький гомолог, EP300, функціонує як транскрипційний коактиватор, тобто за допомогою білок-білкових взаємодій пов'язує різні білкові трансактиватори транскрипції з основним транскрипційним комплексом[5]. Довжина поліпептидного ланцюга білка становить 2 442 амінокислот, а молекулярна маса — 265 351[6]. Вперше дослідники його описали 1993 року[7].

Послідовність амінокислот
1020304050
MAENLLDGPPNPKRAKLSSPGFSANDSTDFGSLFDLENDLPDELIPNGGE
LGLLNSGNLVPDAASKHKQLSELLRGGSGSSINPGIGNVSASSPVQQGLG
GQAQGQPNSANMASLSAMGKSPLSQGDSSAPSLPKQAASTSGPTPAASQA
LNPQAQKQVGLATSSPATSQTGPGICMNANFNQTHPGLLNSNSGHSLINQ
ASQGQAQVMNGSLGAAGRGRGAGMPYPTPAMQGASSSVLAETLTQVSPQM
TGHAGLNTAQAGGMAKMGITGNTSPFGQPFSQAGGQPMGATGVNPQLASK
QSMVNSLPTFPTDIKNTSVTNVPNMSQMQTSVGIVPTQAIATGPTADPEK
RKLIQQQLVLLLHAHKCQRREQANGEVRACSLPHCRTMKNVLNHMTHCQA
GKACQVAHCASSRQIISHWKNCTRHDCPVCLPLKNASDKRNQQTILGSPA
SGIQNTIGSVGTGQQNATSLSNPNPIDPSSMQRAYAALGLPYMNQPQTQL
QPQVPGQQPAQPQTHQQMRTLNPLGNNPMNIPAGGITTDQQPPNLISESA
LPTSLGATNPLMNDGSNSGNIGTLSTIPTAAPPSSTGVRKGWHEHVTQDL
RSHLVHKLVQAIFPTPDPAALKDRRMENLVAYAKKVEGDMYESANSRDEY
YHLLAEKIYKIQKELEEKRRSRLHKQGILGNQPALPAPGAQPPVIPQAQP
VRPPNGPLSLPVNRMQVSQGMNSFNPMSLGNVQLPQAPMGPRAASPMNHS
VQMNSMGSVPGMAISPSRMPQPPNMMGAHTNNMMAQAPAQSQFLPQNQFP
SSSGAMSVGMGQPPAQTGVSQGQVPGAALPNPLNMLGPQASQLPCPPVTQ
SPLHPTPPPASTAAGMPSLQHTTPPGMTPPQPAAPTQPSTPVSSSGQTPT
PTPGSVPSATQTQSTPTVQAAAQAQVTPQPQTPVQPPSVATPQSSQQQPT
PVHAQPPGTPLSQAAASIDNRVPTPSSVASAETNSQQPGPDVPVLEMKTE
TQAEDTEPDPGESKGEPRSEMMEEDLQGASQVKEETDIAEQKSEPMEVDE
KKPEVKVEVKEEEESSSNGTASQSTSPSQPRKKIFKPEELRQALMPTLEA
LYRQDPESLPFRQPVDPQLLGIPDYFDIVKNPMDLSTIKRKLDTGQYQEP
WQYVDDVWLMFNNAWLYNRKTSRVYKFCSKLAEVFEQEIDPVMQSLGYCC
GRKYEFSPQTLCCYGKQLCTIPRDAAYYSYQNRYHFCEKCFTEIQGENVT
LGDDPSQPQTTISKDQFEKKKNDTLDPEPFVDCKECGRKMHQICVLHYDI
IWPSGFVCDNCLKKTGRPRKENKFSAKRLQTTRLGNHLEDRVNKFLRRQN
HPEAGEVFVRVVASSDKTVEVKPGMKSRFVDSGEMSESFPYRTKALFAFE
EIDGVDVCFFGMHVQEYGSDCPPPNTRRVYISYLDSIHFFRPRCLRTAVY
HEILIGYLEYVKKLGYVTGHIWACPPSEGDDYIFHCHPPDQKIPKPKRLQ
EWYKKMLDKAFAERIIHDYKDIFKQATEDRLTSAKELPYFEGDFWPNVLE
ESIKELEQEEEERKKEESTAASETTEGSQGDSKNAKKKNNKKTNKNKSSI
SRANKKKPSMPNVSNDLSQKLYATMEKHKEVFFVIHLHAGPVINTLPPIV
DPDPLLSCDLMDGRDAFLTLARDKHWEFSSLRRSKWSTLCMLVELHTQGQ
DRFVYTCNECKHHVETRWHCTVCEDYDLCINCYNTKSHAHKMVKWGLGLD
DEGSSQGEPQSKSPQESRRLSIQRCIQSLVHACQCRNANCSLPSCQKMKR
VVQHTKGCKRKTNGGCPVCKQLIALCCYHAKHCQENKCPVPFCLNIKHKL
RQQQIQHRLQQAQLMRRRMATMNTRNVPQQSLPSPTSAPPGTPTQQPSTP
QTPQPPAQPQPSPVSMSPAGFPSVARTQPPTTVSTGKPTSQVPAPPPPAQ
PPPAAVEAARQIEREAQQQQHLYRVNINNSMPPGRTGMGTPGSQMAPVSL
NVPRPNQVSGPVMPSMPPGQWQQAPLPQQQPMPGLPRPVISMQAQAAVAG
PRMPSVQPPRSISPSALQDLLRTLKSPSSPQQQQQVLNILKSNPQLMAAF
IKQRTAKYVANQPGMQPQPGLQSQPGMQPQPGMHQQPSLQNLNAMQAGVP
RPGVPPQQQAMGGLNPQGQALNIMNPGHNPNMASMNPQYREMLRRQLLQQ
QQQQQQQQQQQQQQQQGSAGMAGGMAGHGQFQQPQGPGGYPPAMQQQQRM
QQHLPLQGSSMGQMAAQMGQLGQMGQPGLGADSTPNIQQALQQRILQQQQ
MKQQIGSPGQPNPMSPQQHMLSGQPQASHLPGQQIATSLSNQVRSPAPVQ
SPRPQSQPPHSSPSPRIQPQPSPHHVSPQTGSPHPGLAVTMASSIDQGHL
GNPEQSAMLPQLNTPSRSALSSELSLVGDTTGDTLEKFVEGL

Кодований геном білок за функціями належить до ацилтрансфераз, є активатором, має сайти фосфорилювання. Має сайт для зв'язування з іоном цинку. Задіяний у таких біологічних процесах, як регуляція транскрипції, ацетилювання гістонів та негістонових білків, керування біологічними ритмами, взаємодія хазяїн-вірус тощо.

Локалізований у цитоплазмі, ядрі.

Ген

Ген CREBBP у людини розташований на 16-й хромосомі і займає локус 16p13.3. Ген містить 34 екзони і експресується повсюдно[8], зокрема і на ембріональному етапі розвитку. Ген розташований на мінус-ланцюгові[9]. Довжина гена становить близько 190 тисяч пар основ (kb), транскрипція йде від центромери до теломери. Довжина мРНК становить 8,7 kb, з яких на кодувальну послідовність[en] припадає 7,3 kb[10].

Гомологи CREBBP є у багатьох багатоклітинних організмів, зокрема мух, черв'яків і рослин, однак відсутні в нижчих еукаріот, наприклад, дріжджів[11]. У даніо-реріо патерни експресії CREBBP і його метилування відіграють роль у ході розвитку організму[12]. У ящірки анолісу каролінського експресія CBP різна у двох статей[13].

Структура

CREBBP — це білок з молекулярною масою 265 кДа[14], який складається з 2442 амінокислот. Локалізується в ядрі[10]. За будовою він дуже схожий на гомологічний[10] білок p300, разом з яким CBP становить родину коактиваторів p300-CBP[en][11].

Значна частина функціональних доменів цих двох білків високо консервативна. Серед цих доменів 4 відомі трансактиваційні домени (TAD):

  • Перша цистеїн/гістидин-збагачена ділянка (CH1), у яку входить транскрипційний адаптерний цинковий палець 1 (англ. transcriptional adapter zinc finger 1, TAZ1);
  • Домен KIX, який взаємодіє з CREB;
  • Ще одна цистеїн/гістидин-збагачена ділянка (СН3), що містить цинковий палець TAZ2 і цинковий палець типу ZZ;
  • Коактиваторний зв'язувальний домен ядерних рецепторів[en] (англ. nuclear receptor co-activator binding domain, NCBD), також відомий як інтерферон-зв'язуючий домен (англ. interferon-binding domain, IBiD). Ці TAD забезпечують різні білок-білкові взаємодії CBP з ДНК-зв'язувальними факторами транскрипції, ключовими компонентами транскрипційної машинерії та іншими коактиваторами транскрипції (докладніше див. нижче).

Крім того, і p300, і CBP також містять домен з гістонацетилтрансферазною активністю (НАТ), який ацилює гістони та інші білки. Поруч з ним перебуває бромодомен, який зв'язується з ацильованими залишками лізину і може залучати CBP до специфічних сайтів на хромосомах . Поруч з каталітичною ділянкою розташовується ще одна цистеїн / гістидин-збагачена ділянка (CH2), що включає бромодомен і PHD-палець[en], який зв'язується з коферментом А. Наявність цього мотиву унікальна для CBP, він відсутній в інших білків з гістонацетилтрансферазною активністю[11][15][16].

Принципова схема структури CBP / Р300 із зазначенням доменів

Дія на клітинному рівні

Ген CREBBP експресується повсюдно і бере участь у транскрипційній коактиваціі багатьох факторів транскрипції. Білок CREBBP вперше був описаний як ядерний білок, який зв'язується білком CREB. Цей ген, як тепер відомо, відіграє важливу роль в ембріональному розвитку, контролі зростання і підтримці гомеостазу[17]. Показано, що миші, у яких нокаутований ген CREBBP або EP300, який кодує білок Р300, гинуть на ранніх етапах розвитку[18][19]. Крім того, миші, у яких був тільки один функціональний алель кожного з генів CREBBP і EP300 замість двох, також гинули в ході ембріогенезу. Вірогідно, для розвитку ембріона критичне значення має загальний сумарний вміст білків CBP і p300, який в обох випадках становив половину від нормального[18]. На відміну від організму в цілому, окремі клітини можуть розвиватися за відсутності білку CBP або p300. Наприклад, у мишей В- і Т-клітини, позбавлені або CBP, або P300, розвивалися нормально в умовах in vivo, а позбавлені обох білків одночасно гинули[20][21].

CBP, як і p300, підвищує експресію генів-мішеней за допомогою таких основних механізмів:

Nuvola apps kview.svg Зовнішні зображення
Searchtool.svg CBP, пов'язаний з CREB, поблизу промотора гена-мішені

CBP, як і p300, переважно ацилює N-кінцеві хвости гістонів, а саме залишки K12 (лізин 12) і K15 гістона H2B[en], K14 і K18 гістона H3[en] і K5 і K8 гістона H4. Однак CBP ацилює не лише гістони, а й негістонові білки, такі як різні чинники і коактиватори транскрипції. Ці модифікації можуть змінювати білок-білкові взаємодії, взаємодії білків з ДНК, а також ядерну локалізацію білків. Інші важливі партнери CBP і p300 — білки реплікації і репарації ДНК, зокрема, PCNA, FEN1, POLB, TDG. Крім того, CBP і p300 можуть взаємодіяти і з білками, які не мають безпосереднього відношення до хроматину, зокрема, з цикліном Е[en] і циклін-залежною кіназою 2, тим самим беручи участь у регуляції клітинного циклу. CBP і p300 беруть участь в регуляції руйнування транскрипційного фактора p53. Показано, що регіон CH-1 CBP і може проявляти напівубіквітинлігазну активність p53, тим самим безпосередньо впливаючи на його деградацію. Нарешті, CBP, як і p300, можуть ацетилювати білки, пов'язані з ядерним транспортом[en], зокрема, KPNA2 та імпортин-α7[11].

CBP використовується як білок скефолда[en] багатьма транскрипційними факторами, серед яких JUN, c-myb, MYOD1, E2F1, YY1, а також члени надродини рецепторів стероїдних гормонів[en] (повний список білків, з якими взаємодіє CBP, див. нижче)[23].

Результати останніх (станом на 2009 рік) досліджень показали, що CBP-опосередковане посттрансляційне N-глікозилювання[en] змінює конформацію білків, що взаємодіють з CBP, регулюючи таким чином експресію генів, клітинний ріст і диференціацію[24].

Фізіологічні функції

CBP задіяний у сигнальних шляхах G-білків і через них бере участь у відповіді клітини на зв'язування адреналіну. Деякі G-білки в активованому стані стимулюють аденілатциклазу, внаслідок чого рівень цАМФ у клітині підвищується. цАМФ активує протеїнкіназу А (PKA), яка складається з чотирьох субодиниць: двох регуляторних і двох каталітичних. Зв'язування цАМФ з регуляторними субодиницями викликає звільнення каталітичних субодиниць, які внаслідок цього можуть переміститися в ядро і взаємодіяти з транскрипційними факторами, таким чином впливаючи на експресію генів. Транскрипційний фактор CREB зв'язується з послідовністю ДНК, що має назву елемент відгуку на цАМФ (CRE). Він фосфорилюється протеїнкіназою A по залишку серину (Ser 133) в домені KID. Ця модифікація стимулює взаємодію домену KID CREB з доменом KIX CBP або p300, внаслідок чого посилюється транскрипція генів, підконтрольних CREB, зокрема і тих, які беруть участь у глюконеогенезі. Цей сигнальний шлях запускається при зв'язуванні адреналіну з клітиною-мішенню[25].

Величезна кількість експериментальних даних свідчать про ключову роль ацетилювання гістонів у пластичності синапсів у ссавців (зокрема довготривалої потенціації), пам'яті та поведінкової адаптації до навколишнього середовища. Початкові свідоцтва пов'язані зі спостереженням, що стосуються хворих синдромом Рубінштейна — Тейбі: у них мутації, що зачіпають CBP, призводять до розумової відсталості. Крім того, миші, мутантні за CREBBP, мали порушення довготривалої пам'яті[26]. Подальші експерименти показали, що CBP важливий не для для нейронної пластичності, але й для виживання нейронів, пов'язаного з їхньою активністю[27], і нейрогенезом[28].

Порушення з боку імунної системи, які проявляються у пацієнтів з синдромом Рубінштейна — Тейбі, свідчать про важливу роль CBP у функціонуванні імунної системи і запальних процесах. Ймовірно, цей ефект обумовлений ненормально зниженою експресією таких важливих для імунітету білків, як CREB, NF-κB, c-jun, c-Fos, BCL2 і c-Myc, обумовленою відсутністю активності CBP[29]. Справді, регулюючи активність транскрипційних факторів NF-κB і AP-1[en], які активують гени, пов'язані з хронічним і гострим запаленням, CBP може відігравати важливу роль у контролі запалення на рівні транскрипції[30]. Встановлено, що CBP задіяний в експресії білка CD59, який бере участь у захисті клітин організму від атак з боку системи комплементу[31].

CBP відіграє важливу роль у функціонуванні жіночої репродуктивної системи. На мишах показано, що він необхідний для експресії лютеїнізуючого гормону-бета і підтримки нормальної фертильності[32]. Крім того, CBP необхідний для експресії генів-мішеней лютеїнізуючого гормону під час овуляції[33]. Він також бере участь у клітинній відповіді на зв'язування естрогену[34].

CBP і p300 відіграють важливу роль у функціонуванні фоторецепторів (паличок і колбочок): колбочко-паличковий гомеобоксовий білок (англ. cone-rod homeobox protein, CRX) залучає їх до промоторів необхідних генів, де вони ацетилюють гістони і сприяють їх експресії. Цікаво, що нокаут одного з генів CREBBP і EP300 не чинив майже ніякого ефекту на фоторецепторні клітини, а нокаут обох генів сильно змінював їхню морфологію і функціонування. Такий ефект був пов'язаний зі зниженням ацетилювання гістонів H3 і H4, що є наслідком дисфункції і p300[35].

Показано можливість участі CBP в адипогенезі[en][36].

Регуляція

Ацетилтрансферазна активність CBP позитивно регулюється фосфорилюванням MAP-кінази MAPK1/MAPK3, Cdk2 і протеїнкіназою А. При цьому фосфорилювання консервативного залишку серину в положенні 89 (S89) протеїнкіназою C-δ знижує ацетилтрансферазну активність CBP. Ацетилтрансферазна активність CBP може змінюватися (як в позитивний, так і в негативний бік) при взаємодії з іншими білками. Наприклад, вона посилюється при взаємодії з такими транскрипційними факторами, як C/EBP[en]-α, NFE2 і HNF-1α і знижується при взаємодії з транскрипційним фактором PU.1. При цьому всі перераховані білки взаємодіють з одним і тим самим сайтом CBP — ділянкою CH3. Механізми того, як білки, які взаємодіють з CBP в одному і тому ж сайті, впливають на його активність протилежним чином, станом на 2017 рік не зрозумілі[11].

Станом на 2017 рік розробляються штучні інгібітори CBP, деякі з яких можуть знайти потенційне застосування в медицині (наприклад, ICG-001 пригнічує ріст ракових клітин у підшлунковій залозі[37]). Інгібітори можуть зв'язуватися, наприклад, з бромодоменом CBP[38][39].

Клінічне значення

Синдром Рубінштейна — Тейбі

Хворі на синдром Рубінштейна — Тейбі з характерними лицьовими аномаліями

Мутації в гені CREBBP викликають синдром Рубінштейна — Тейбі (RTS)[40]. Однак RTS може розвиватися і при мутаціях гена EP300. Пацієнти з RTS характеризуються множинними вродженими вадами, відставанням у розумовому і післяродовому[en] розвитку, мікроцефалією, характерними лицьовими аномаліями, широкими, часто загостреними пальцями рук і збільшеними пальцями ніг. Частота розповсюдженості цього захворювання становить 1 випадок на 100 тисяч-125 тисяч новонароджених[41]. Зазвичай пацієнти з RTS мають підвищений ризик розвитку пухлин. У людини фенотипи, які проявляються при гаплонедостатності по CREBBP і при дрібних делеціях і мутаціях, що призводять до утворення укороченої форми білка, не розрізняються. У мишей гетерозиготна делеція або вкорочення CBP призводить до фенотипу, який нагадує RTS. Список описаних мутацій CREBBP, що призводять до розвитку RTS, постійно поповнюється[42][43]. У загальному випадку до RTS призводять ті мутації CREBBP, які пригнічують його гістонацетилтрансферазну активність[11].

Гострий мієлоїдний лейкоз

Хромосомні транслокації, що зачіпають CREBBP, пов'язують з гострим мієлоїдним лейкозом (AML)[17][44]. До AML також можуть призводити транслокації в EP300. Ба більше, транслокації, що зачіпають CREBBP і викликають AML, можуть бути наслідком протиракової хіміотерапії (наприклад, при лікуванні раку молочної залози)[45]. У разі цих збалансованих транслокацій 5'-кінець генів MLL, MOZ або MORF зшивається з 3'-кінцем гена CBP або p300, і навпаки. Це призводить до утворення химерних білків, наприклад, MLL-CBP і CBP-MLL. Химерні білки, у яких CBP (p300) зливається з іншим своїм C-кінцем (MLL–CBP, MLL–p300, MOZ–CBP, MOZ–p300, MORF–CBP), мабуть, відіграють ключову роль у розвитку лейкемій, а матричні РНК, що кодують зворотні білки (наприклад, CBP-MLL), у пацієнтів з AML не виявлені. На відміну від RTS, при якому CBP і p300 нефункціональні, в разі описаних вище транслокацій HAT-домени CBP і p300 залишаються інтактними в химерних білках. Однак CBP і p300 починають працювати неправильно (наприклад, вони працюють не з тими послідовностями), тому у випадку AML мають місце мутації набуття, а не втрати функції[11].

Інші ракові захворювання

На відміну від p300, який є класичним супресором пухлин, ситуація з CBP менш зрозуміла. З одного боку, схильність до пухлиноутворення у пацієнтів з RTS, а також той факт, що і CBP, і p300 є мішенями вірусів, що змінюють ДНК (аденовірус, SV40, вірус папіломи людини), говорить про те, що CBP теж може функціонувати як пухлинний супресор. Однак у тих пухлинних клітинах, у яких були мутації в CREBBP, мутованою виявився тільки один аллель, інший залишився інтактним і функціональним. Це суперечить уявленню про CBP як про класичний пухлинний супресор[11]. Роль CBP показано в таких видах раку, як рак товстої кишки[46], легень[47][48], підшлункової залози[37] та інших ракових захворюваннях.

Встановлено, що CBP-залежний сигнальний шлях Wnt / β-Катенін перебуває в постійно активованому стані в ракових клітинах, що стійкі до дії протипухлинного препарату доксорубіцину. Порушення взаємодії CBP з β-катеніном, що зупиняє роботу сигнального шляху, фармакологічним шляхом може відновити чутливість ракових клітин до цього препарату і поліпшити прогноз для пацієнта[49]. Крім того, показано, що інгібітор комплексу CREB-CBP, нафтол-AS-TR-фосфату, можна застосовувати для лікування раку легень[50].

Порушення з боку нервової системи

Багато нейродегенеративних захворювань людини (хорея Гантінгтона (HD), синдром Кенеді[en] та інші) пов'язані з подовженням області поліглутамінових повторів у певних білках (зокрема, гантінгтіні в разі HD і андрогеновому рецепторі при синдромі Кенеді), яке призводить до утворення нерозчинних агрегатів. Вони можуть зв'язуватися з поліглутаміновими трактами нормальних білків, зокрема, CBP, який має ділянку з 18 залишків глутаміну (залишки 2199—2216) у своєму Q-збагаченому C-кінці. При зв'язуванні з такими агрегатами відбувається інактивація CBP, яка, мабуть, і обумовлює їх токсичність: ектопічна[en] надекспресія CBP зменшувала смертність клітин в культурі, викликану утворенням глутамінових агрегатів. Експерименти з дрозофілами показали, що розвиток нейродегенеративного фенотипу пригнічувався при обробці інгібіторами деацетилаз, що є доказом необхідності гістонацетилтрансферазної функції CBP для запобігання розвитку нейродегенеративних захворювань[11].

Показано участь CBP (і p300) в апоптозі нейронів, який відбувається при хворобі Альцгеймера (AD). Передбачається, що при цьому CBP руйнується каспазою-6, що знижує рівень ацетилювання гістонів. Цікаво, що збільшення вмісту CBP пов'язане з раннім розвитком AD. Продемонстровано, що опосередковане пресеніліном-1 розрізання N-кадгеринів призводило до утворення пептиду N-Cad / CTF2, який в цитоплазмі зв'язується з CBP і сприяє його протеасомному руйнуванню. Зменшення кількості CBP призводить до пригнічення транскрипції генів, які активуються CREB. Варто відзначити, що мутації пресеніліна-1 спостерігаються при сімейних формах AD, причому вони можуть призводити як втрати, так і набуття функції CBP[11]. Крім того, показано, що CBP функціонує як регулятор циркадних ритмів, і його руйнування, індуковане бета-амілоїдом, призводить до порушення циркадних ритмів при AD[51]. Є дані, що свідчать про зв'язок CBP з розвитком бічного аміотрофічного склерозу. Передбачають, що препарати, які компенсують втрату функції CBP, можна застосовувати в лікуванні нейродегенеративних захворювань[52].

Є дані, що порушення гістонацетилтрансферазної активності CBP викликає проблеми при формуванні довготривалої пам'яті[53].

CBP може бути залучений у розвиток деяких психіатричних порушень. Дослідження 2012 року показало, що однонуклеотидні поліморфізми в гені CREBBP можуть бути асоційовані з розвитком шизофренії[54], значного депресивного розладу і біполярного афективного розладу і впливати на відповідь пацієнтів на лікування[55]. Ба більше, поліморфізми в цьому гені можуть бути пов'язані з чутливістю до наркотичних речовин, наприклад, героїну, а також алкоголю, і слугувати факторами розвитку звикання до них[56]. В прилеглому ядрі CBP регулює індуковане кокаїном ацетилювання гістонів і необхідний для розвитку поведінкових реакцій, пов'язаних з вживанням кокаїну[57].

Інші захворювання

CBP і p300 часто є мішенями вірусів[23]. Наприклад, показано, що коров'ячий білок вірусу гепатиту B підсилює транскрипцію генів, підконтрольних CRE, діючи на шлях CRE/CREB/CBP[58].

У 2012 році було показано участь CBP в розвитку муковісцидоз а[59].

Взаємодії з іншими білками

У таблиці нижче перераховані ключові білки, які взаємодіють з різними доменами CREBBP[16].

Домен Білки, які
з ним взаємодіють
Група
TAZ1 TBP
p53
FOXO3
HIF1A
CITED2
STAT2[16]
загальний транскрипційний фактор
транскрипційний фактор
транскрипційний фактор
транскрипційний фактор
транскрипційний фактор
транскрипційний фактор
KIX (сайт c-Myb) CREB
c-Myb
p53
FOXO3a[16]
транскрипційний фактор
транскрипційний фактор
транскрипційний фактор
транскрипційний фактор
KIX (сайт MLL) MLL
p53
FOXO3a
HTLV-1HBZ
C-jun
E2A
HTLV-1 Tax
транскрипційний фактор
транскрипційний фактор
транскрипційний фактор
транскрипційний фактор
транскрипційний фактор
транскрипційний фактор
Вірусний білок
KIX (два сайти) p53
FOXO3a
транскрипційний фактор
транскрипційний фактор
KIX (сайт
зв'язування невідомий)
BRCA1
SREBP
транскрипційний фактор
транскрипційний фактор
бромодомен Гістон H4
p53
гістон
транскрипційний фактор
TAZ2 E1A[en]
TFIIB
KAT2B
GCN5
p53
FOXO3a
STAT1
MEF2[en]
білок аденовірусу
Загальний транскрипційний фактор
Коактиватор
Коактиватор
транскрипційний фактор
транскрипційний фактор
транскрипційний фактор
транскрипційний фактор
NCBD (IBid) p53
IRF3
ACTR[16]
транскрипційний фактор
транскрипційний фактор
Коактиватор
Мотиви LXXLL Ретиноїдний X-рецептор[en]
Естрогеновий рецептор
Андрогеновий рецептор[16]
ядерний рецептор
Ядерний рецептор
Ядерний рецептор

Література

  • Yang X.-J., Ogryzko V.V., Nishikawa J., Howard B.H., Nakatani Y. (1996). A p300/CBP-associated factor that competes with the adenoviral oncoprotein E1A.. Nature 382: 319 — 324.  PubMed DOI:10.1038/382319a0
  • Bex F., Yin M.-J., Burny A., Gaynor R.B. (1998). Differential transcriptional activation by human T-cell leukemia virus type 1 Tax mutants is mediated by distinct interactions with CREB binding protein and p300.. Mol. Cell. Biol. 18: 2392 — 2405.  PubMed DOI:10.1128/MCB.18.4.2392
  • Zhang W., Bieker J.J. (1998). Acetylation and modulation of erythroid Krueppel-like factor (EKLF) activity by interaction with histone acetyltransferases.. Proc. Natl. Acad. Sci. U.S.A. 95: 9855 — 9860.  PubMed DOI:10.1073/pnas.95.17.9855
  • Johnston H., Kneer J., Chackalaparampil I., Yaciuk P., Chrivia J. (1999). Identification of a novel SNF2/SWI2 protein family member, SRCAP, which interacts with CREB-binding protein.. J. Biol. Chem. 274: 16370 — 16376.  PubMed DOI:10.1074/jbc.274.23.16370
  • Doucas V., Tini M., Egan D.A., Evans R.M. (1999). Modulation of CREB binding protein function by the promyelocytic (PML) oncoprotein suggests a role for nuclear bodies in hormone signaling.. Proc. Natl. Acad. Sci. U.S.A. 96: 2627 — 2632.  PubMed DOI:10.1073/pnas.96.6.2627
  • Chen H., Lin R.J., Xie W., Wilpitz D., Evans R.M. (1999). Regulation of hormone-induced histone hyperacetylation and gene activation via acetylation of an acetylase.. Cell 98: 675 — 686.  PubMed DOI:10.1016/S0092-8674(00)80054-9

Примітки

  1. Захворювання, генетично пов'язані з CREBBP переглянути/редагувати посилання на ВікіДаних. 
  2. Human PubMed Reference:. 
  3. Mouse PubMed Reference:. 
  4. HUGO Gene Nomenclature Commitee, HGNC:2348 (англ.). Процитовано 11 вересня 2017. 
  5. PMID 9343424 (PubMed)
    Бібліографічний опис з'явиться автоматично через деякий час. Ви можете підставити цитату власноруч або використовуючи бота.
  6. UniProt, Q92793 (англ.). Процитовано 11 вересня 2017. 
  7. PMID 8413673 (PubMed)
    Бібліографічний опис з'явиться автоматично через деякий час. Ви можете підставити цитату власноруч або використовуючи бота.
  8. NCBI. CREBBP CREB binding protein [ Homo sapiens (human) ]. 
  9. GenAge entry for CREBBP (Homo sapiens). 
  10. а б в Jean-Loup Huret. CBP (CREB-binding protein) // Atlas of Genetics and Cytogenetics in Oncology and Haematology. — 2000. — DOI:10.4267/2042/37634.
  11. а б в г д е ж и к л PMID 15313412 (PubMed)
    Бібліографічний опис з'явиться автоматично через деякий час. Ви можете підставити цитату власноруч або використовуючи бота.
  12. PMID 26260685 (PubMed)
    Бібліографічний опис з'явиться автоматично через деякий час. Ви можете підставити цитату власноруч або використовуючи бота.
  13. PMID 26363452 (PubMed)
    Бібліографічний опис з'явиться автоматично через деякий час. Ви можете підставити цитату власноруч або використовуючи бота.
  14. PMID 7606928 (PubMed)
    Бібліографічний опис з'явиться автоматично через деякий час. Ви можете підставити цитату власноруч або використовуючи бота.
  15. PMID 15479634 (PubMed)
    Бібліографічний опис з'явиться автоматично через деякий час. Ви можете підставити цитату власноруч або використовуючи бота.
  16. а б в г д е PMID 23307074 (PubMed)
    Бібліографічний опис з'явиться автоматично через деякий час. Ви можете підставити цитату власноруч або використовуючи бота.
  17. а б Entrez Gene: CREBBP (CREB-binding protein). 
  18. а б PMID 9590171 (PubMed)
    Бібліографічний опис з'явиться автоматично через деякий час. Ви можете підставити цитату власноруч або використовуючи бота.
  19. PMID 10906457 (PubMed)
    Бібліографічний опис з'явиться автоматично через деякий час. Ви можете підставити цитату власноруч або використовуючи бота.
  20. PMID 16428436 (PubMed)
    Бібліографічний опис з'явиться автоматично через деякий час. Ви можете підставити цитату власноруч або використовуючи бота.
  21. PMID 16424387 (PubMed)
    Бібліографічний опис з'явиться автоматично через деякий час. Ви можете підставити цитату власноруч або використовуючи бота.
  22. PMID 10887150 (PubMed)
    Бібліографічний опис з'явиться автоматично через деякий час. Ви можете підставити цитату власноруч або використовуючи бота.
  23. а б PMID 9238849 (PubMed)
    Бібліографічний опис з'явиться автоматично через деякий час. Ви можете підставити цитату власноруч або використовуючи бота.
  24. PMID 19578754 (PubMed)
    Бібліографічний опис з'явиться автоматично через деякий час. Ви можете підставити цитату власноруч або використовуючи бота.
  25. PMID 11483993 (PubMed)
    Бібліографічний опис з'явиться автоматично через деякий час. Ви можете підставити цитату власноруч або використовуючи бота.
  26. PMID 21673711 (PubMed)
    Бібліографічний опис з'явиться автоматично через деякий час. Ви можете підставити цитату власноруч або використовуючи бота.
  27. PMID 12909086 (PubMed)
    Бібліографічний опис з'явиться автоматично через деякий час. Ви можете підставити цитату власноруч або використовуючи бота.
  28. PMID 21847097 (PubMed)
    Бібліографічний опис з'явиться автоматично через деякий час. Ви можете підставити цитату власноруч або використовуючи бота.
  29. PMID 23643710 (PubMed)
    Бібліографічний опис з'явиться автоматично через деякий час. Ви можете підставити цитату власноруч або використовуючи бота.
  30. PMID 12168567 (PubMed)
    Бібліографічний опис з'явиться автоматично через деякий час. Ви можете підставити цитату власноруч або використовуючи бота.
  31. PMID 24338025 (PubMed)
    Бібліографічний опис з'явиться автоматично через деякий час. Ви можете підставити цитату власноруч або використовуючи бота.
  32. PMID 22508984 (PubMed)
    Бібліографічний опис з'явиться автоматично через деякий час. Ви можете підставити цитату власноруч або використовуючи бота.
  33. PMID 24878634 (PubMed)
    Бібліографічний опис з'явиться автоматично через деякий час. Ви можете підставити цитату власноруч або використовуючи бота.
  34. PMID 22083956 (PubMed)
    Бібліографічний опис з'явиться автоматично через деякий час. Ви можете підставити цитату власноруч або використовуючи бота.
  35. PMID 23922782 (PubMed)
    Бібліографічний опис з'явиться автоматично через деякий час. Ви можете підставити цитату власноруч або використовуючи бота.
  36. PMID 26113042 (PubMed)
    Бібліографічний опис з'явиться автоматично через деякий час. Ви можете підставити цитату власноруч або використовуючи бота.
  37. а б PMID 25082960 (PubMed)
    Бібліографічний опис з'явиться автоматично через деякий час. Ви можете підставити цитату власноруч або використовуючи бота.
  38. PMID 26043365 (PubMed)
    Бібліографічний опис з'явиться автоматично через деякий час. Ви можете підставити цитату власноруч або використовуючи бота.
  39. PMID 26125948 (PubMed)
    Бібліографічний опис з'явиться автоматично через деякий час. Ви можете підставити цитату власноруч або використовуючи бота.
  40. PMID 7630403 (PubMed)
    Бібліографічний опис з'явиться автоматично через деякий час. Ви можете підставити цитату власноруч або використовуючи бота.
  41. PMID 23162289 (PubMed)
    Бібліографічний опис з'явиться автоматично через деякий час. Ви можете підставити цитату власноруч або використовуючи бота.
  42. PMID 26275701 (PubMed)
    Бібліографічний опис з'явиться автоматично через деякий час. Ви можете підставити цитату власноруч або використовуючи бота.
  43. PMID 25805166 (PubMed)
    Бібліографічний опис з'явиться автоматично через деякий час. Ви можете підставити цитату власноруч або використовуючи бота.
  44. PMID 12619164 (PubMed)
    Бібліографічний опис з'явиться автоматично через деякий час. Ви можете підставити цитату власноруч або використовуючи бота.
  45. PMID 25548695 (PubMed)
    Бібліографічний опис з'явиться автоматично через деякий час. Ви можете підставити цитату власноруч або використовуючи бота.
  46. PMID 26217075 (PubMed)
    Бібліографічний опис з'явиться автоматично через деякий час. Ви можете підставити цитату власноруч або використовуючи бота.
  47. PMID 26318425 (PubMed)
    Бібліографічний опис з'явиться автоматично через деякий час. Ви можете підставити цитату власноруч або використовуючи бота.
  48. PMID 24551300 (PubMed)
    Бібліографічний опис з'явиться автоматично через деякий час. Ви можете підставити цитату власноруч або використовуючи бота.
  49. PMID 25968898 (PubMed)
    Бібліографічний опис з'явиться автоматично через деякий час. Ви можете підставити цитату власноруч або використовуючи бота.
  50. PMID 25897662 (PubMed)
    Бібліографічний опис з'явиться автоматично через деякий час. Ви можете підставити цитату власноруч або використовуючи бота.
  51. PMID 25888034 (PubMed)
    Бібліографічний опис з'явиться автоматично через деякий час. Ви можете підставити цитату власноруч або використовуючи бота.
  52. PMID 15313413 (PubMed)
    Бібліографічний опис з'явиться автоматично через деякий час. Ви можете підставити цитату власноруч або використовуючи бота.
  53. PMID 15207240 (PubMed)
    Бібліографічний опис з'явиться автоматично через деякий час. Ви можете підставити цитату власноруч або використовуючи бота.
  54. PMID 22198373 (PubMed)
    Бібліографічний опис з'явиться автоматично через деякий час. Ви можете підставити цитату власноруч або використовуючи бота.
  55. PMID 22386572 (PubMed)
    Бібліографічний опис з'явиться автоматично через деякий час. Ви можете підставити цитату власноруч або використовуючи бота.
  56. PMID 21752352 (PubMed)
    Бібліографічний опис з'явиться автоматично через деякий час. Ви можете підставити цитату власноруч або використовуючи бота.
  57. PMID 22114264 (PubMed)
    Бібліографічний опис з'явиться автоматично через деякий час. Ви можете підставити цитату власноруч або використовуючи бота.
  58. PMID 25936964 (PubMed)
    Бібліографічний опис з'явиться автоматично через деякий час. Ви можете підставити цитату власноруч або використовуючи бота.
  59. PMID 22467641 (PubMed)
    Бібліографічний опис з'явиться автоматично через деякий час. Ви можете підставити цитату власноруч або використовуючи бота.

Див. також