KIF13B

Матеріал з Вікіпедії — вільної енциклопедії.
Перейти до навігації Перейти до пошуку
KIF13B
Наявні структури
PDBПошук ортологів: PDBe RCSB
Ідентифікатори
Символи KIF13B, GAKIN, kinesin family member 13B
Зовнішні ІД OMIM: 607350 MGI: 1098265 HomoloGene: 9073 GeneCards: KIF13B
Ортологи
Види Людина Миша
Entrez
Ensembl
UniProt
RefSeq (мРНК)
NM_015254
NM_001081177
RefSeq (білок)
NP_056069
NP_001074646
Локус (UCSC) Хр. 8: 29.07 – 29.26 Mb Хр. 14: 64.65 – 64.81 Mb
PubMed search [1] [2]
Вікідані
Див./Ред. для людейДив./Ред. для мишей

KIF13B (англ. Kinesin family member 13B) – білок, який кодується однойменним геном, розташованим у людей на короткому плечі 8-ї хромосоми.[3] Довжина поліпептидного ланцюга білка становить 1 826 амінокислот, а молекулярна маса — 202 789[4].

Послідовність амінокислот
1020304050
MGDSKVKVAVRIRPMNRRETDLHTKCVVDVDANKVILNPVNTNLSKGDAR
GQPKVFAYDHCFWSMDESVKEKYAGQDIVFKCLGENILQNAFDGYNACIF
AYGQTGSGKSYTMMGTADQPGLIPRLCSGLFERTQKEENEEQSFKVEVSY
MEIYNEKVRDLLDPKGSRQTLKVREHSVLGPYVDGLSKLAVTSYKDIESL
MSEGNKSRTVAATNMNEESSRSHAVFKITLTHTLYDVKSGTSGEKVGKLS
LVDLAGSERATKTGAAGDRLKEGSNINKSLTTLGLVISALADQSAGKNKN
KFVPYRDSVLTWLLKDSLGGNSKTAMVATVSPAADNYDETLSTLRYADRA
KHIVNHAVVNEDPNARIIRDLREEVEKLREQLTKAEAMKSPELKDRLEES
EKLIQEMTVTWEEKLRKTEEIAQERQKQLESLGISLQSSGIKVGDDKCFL
VNLNADPALNELLVYYLKEHTLIGSANSQDIQLCGMGILPEHCIIDITSE
GQVMLTPQKNTRTFVNGSSVSSPIQLHHGDRILWGNNHFFRLNLPKKKKK
AEREDEDQDPSMKNENSSEQLDVDGDSSSEVSSEVNFNYEYAQMEVTMKA
LGSNDPMQSILNSLEQQHEEEKRSALERQRLMYEHELEQLRRRLSPEKQN
CRSMDRFSFHSPSAQQRLRQWAEEREATLNNSLMRLREQIVKANLLVREA
NYIAEELDKRTEYKVTLQIPASSLDANRKRGSLLSEPAIQVRRKGKGKQI
WSLEKLDNRLLDMRDLYQEWKECEEDNPVIRSYFKRADPFYDEQENHSLI
GVANVFLESLFYDVKLQYAVPIINQKGEVAGRLHVEVMRLSGDVGERIAG
GDEVAEVSFEKETQENKLVCMVKILQATGLPQHLSHFVFCKYSFWDQQEP
VIVAPEVDTSSSSVSKEPHCMVVFDHCNEFSVNITEDFIEHLSEGALAIE
VYGHKINDPRKNPALWDLGIIQAKTRSLRDRWSEVTRKLEFWVQILEQNE
NGEYCPVEVISAKDVPTGGIFQLRQGQSRRVQVEVKSVQESGTLPLMEEC
ILSVGIGCVKVRPLRAPRTHETFHEEEEDMDSYQDRDLERLRRKWLNALT
KRQEYLDQQLQKLVSKRDKTEDDADREAQLLEMRLTLTEERNAVMVPSAG
SGIPGAPAEWTPVPGMETHIPVIFLDLNADDFSSQDNLDDPEAGGWDATL
TGEEEEEFFELQIVKQHDGEVKAEASWDSAVHGCPQLSRGTPVDERLFLI
VRVTVQLSHPADMQLVLRKRICVNVHGRQGFAQSLLKKMSHRSSIPGCGV
TFEIVSNIPEDAQGVEEREALARMAANVENPASADSEAYIEKYLRSVLAV
ENLLTLDRLRQEVAVKEQLTGKGKLSRRSISSPNVNRLSGSRQDLIPSYS
LGSNKGRWESQQDVSQTTVSRGIAPAPALSVSPQNNHSPDPGLSNLAASY
LNPVKSFVPQMPKLLKSLFPVRDEKRGKRPSPLAHQPVPRIMVQSASPDI
RVTRMEEAQPEMGPDVLVQTMGAPALKICDKPAKVPSPPPVIAVTAVTPA
PEAQDGPPSPLSEASSGYFSHSVSTATLSDALGPGLDAAAPPGSMPTAPE
AEPEAPISHPPPPTAVPAEEPPGPQQLVSPGRERPDLEAPAPGSPFRVRR
VRASELRSFSRMLAGDPGCSPGAEGNAPAPGAGGQALASDSEEADEVPEW
LREGEFVTVGAHKTGVVRYVGPADFQEGTWVGVELDLPSGKNDGSIGGKQ
YFRCNPGYGLLVRPSRVRRATGPVRRRSTGLRLGAPEARRSATLSGSATN
LASLTAALAKADRSHKNPENRKSWAS

Кодований геном білок за функціями належить до білкових моторів, фосфопротеїнів. Задіяний у такому біологічному процесі, як альтернативний сплайсинг. Білок має сайт для зв'язування з АТФ, нуклеотидами. Локалізований у цитоплазмі, цитоскелеті, клітинних відростках.

Література

  • Hanada T., Lin L., Tibaldi E.V., Reinherz E.L., Chishti A.H. (2000). GAKIN, a novel kinesin-like protein associates with the human homologue of the Drosophila discs large tumor suppressor in T lymphocytes.. J. Biol. Chem. 275: 28774 — 28784.  PubMed DOI:10.1074/jbc.M000715200
  • Yoshimura Y., Terabayashi T., Miki H. (2010). Par1b/MARK2 phosphorylates kinesin-like motor protein GAKIN/KIF13B to regulate axon formation.. Mol. Cell. Biol. 30: 2206 — 2219.  PubMed DOI:10.1128/MCB.01181-09

Примітки

  1. Human PubMed Reference:. 
  2. Mouse PubMed Reference:. 
  3. HUGO Gene Nomenclature Commitee, HGNC:14405 (англ.). Процитовано 7 вересня 2017. 
  4. UniProt, Q9NQT8 (англ.). Процитовано 7 вересня 2017. 

Див. також