Відмінності між версіями «PDCD1»

Матеріал з Вікіпедії — вільної енциклопедії.
Перейти до навігації Перейти до пошуку
[перевірена версія][неперевірена версія]
(доповнення, оновлення даних)
Рядок 2: Рядок 2:
 
'''PDCD1''' ({{lang-en|Programmed cell death 1}}) – білок, який кодується однойменним геном, розташованим у людей на короткому плечі 2-ї хромосоми. <ref name="HGNC">{{cite web|url=http://www.genenames.org/cgi-bin/gene_symbol_report?hgnc_id=HGNC:8760 |title=HUGO Gene Nomenclature Commitee, HGNC:8760 |language=англ. |accessdate=28 серпня 2017}}</ref> Довжина поліпептидного ланцюга білка становить 288 [[Амінокислоти|амінокислот]], а [[молекулярна маса]] — 31 647<ref name="UniProt">{{cite web|url=http://www.uniprot.org/uniprot/Q15116#sequences |title=UniProt, Q15116 |language=англ. |accessdate=28 серпня 2017}}</ref>.
 
'''PDCD1''' ({{lang-en|Programmed cell death 1}}) – білок, який кодується однойменним геном, розташованим у людей на короткому плечі 2-ї хромосоми. <ref name="HGNC">{{cite web|url=http://www.genenames.org/cgi-bin/gene_symbol_report?hgnc_id=HGNC:8760 |title=HUGO Gene Nomenclature Commitee, HGNC:8760 |language=англ. |accessdate=28 серпня 2017}}</ref> Довжина поліпептидного ланцюга білка становить 288 [[Амінокислоти|амінокислот]], а [[молекулярна маса]] — 31 647<ref name="UniProt">{{cite web|url=http://www.uniprot.org/uniprot/Q15116#sequences |title=UniProt, Q15116 |language=англ. |accessdate=28 серпня 2017}}</ref>.
   
  +
  +
==Відкриття==
  +
На екрані для генів, залучених до апоптозу, Ясумаса Ісіда, Тасуку Хенджо і його колеги з Університету Кіото в 1992 році виявили і назвали ПД-1.<ref name="Ishida_1992">{{cite journal | vauthors = Ishida Y, Agata Y, Shibahara K, Honjo T | title = Induced expression of PD-1, a novel member of the immunoglobulin gene superfamily, upon programmed cell death | journal = The EMBO Journal | volume = 11 | issue = 11 | pages = 3887–95 | date = November 1992 | pmid = 1396582 | pmc = 556898 | doi = 10.1002/j.1460-2075.1992.tb05481.x}}</ref><ref name="Bardhan_2016">{{cite journal | vauthors = Bardhan K, Anagnostou T, Boussiotis VA | title = The PD1:PD-L1/2 Pathway from Discovery to Clinical Implementation | journal = Frontiers in Immunology | volume = 7 | issue = | pages = 550 | date = 2016 | pmid = 28018338 | pmc = 5149523 | doi = 10.3389/fimmu.2016.00550 }}</ref> У 1999 році одна і та ж група продемонструвала, що миші, де PD-1 були збиті, були схильні до аутоімунного захворювання, і тому прийшли до висновку, що PD-1 є негативним регулятором імунних відповідей.<ref name="Bardhan_2016" />
 
{{hidden
 
{{hidden
 
|header=Послідовність амінокислот
 
|header=Послідовність амінокислот

Версія за 05:53, 2 липня 2019

Programmed cell death 1
Ідентифікатори
Символи protein PD-1PDCD1programmed cell death protein 1programmed cell death 1 proteinsystemic lupus erythematosus susceptibility 2Programmed Cell Death 1 Receptor
Зовнішні ІД GeneCards: [1]
Ортологи
Види Людина Миша
Entrez
Ensembl
UniProt
RefSeq (мРНК)
н/д
н/д
RefSeq (білок)
н/д
н/д
Локус (UCSC) н/д н/д
PubMed search н/д н/д
Вікідані
Див./Ред. для людей

PDCD1 (англ. Programmed cell death 1) – білок, який кодується однойменним геном, розташованим у людей на короткому плечі 2-ї хромосоми. [1] Довжина поліпептидного ланцюга білка становить 288 амінокислот, а молекулярна маса — 31 647[2].


Відкриття

На екрані для генів, залучених до апоптозу, Ясумаса Ісіда, Тасуку Хенджо і його колеги з Університету Кіото в 1992 році виявили і назвали ПД-1.[3][4] У 1999 році одна і та ж група продемонструвала, що миші, де PD-1 були збиті, були схильні до аутоімунного захворювання, і тому прийшли до висновку, що PD-1 є негативним регулятором імунних відповідей.[4]

Послідовність амінокислот
1020304050
MQIPQAPWPVVWAVLQLGWRPGWFLDSPDRPWNPPTFSPALLVVTEGDNA
TFTCSFSNTSESFVLNWYRMSPSNQTDKLAAFPEDRSQPGQDCRFRVTQL
PNGRDFHMSVVRARRNDSGTYLCGAISLAPKAQIKESLRAELRVTERRAE
VPTAHPSPSPRPAGQFQTLVVGVVGGLLGSLVLLVWVLAVICSRAARGTI
GARRTGQPLKEDPSAVPVFSVDYGELDFQWREKTPEPPVPCVPEQTEYAT
IVFPSGMGTSSPARRGSADGPRSAQPLRPEDGHCSWPL

Задіяний у таких біологічних процесах як апоптоз, імунітет, поліморфізм. Локалізований у мембрані.

Література

  • Shinohara T., Taniwaki M., Ishida Y., Kawaich M., Honjo T. (1994). Structure and chromosomal localization of the human PD-1 gene (PDCD1).. Genomics 23: 704 — 706.  PubMed DOI:10.1006/geno.1994.1562
  • The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).. Genome Res. 14: 2121 — 2127. 2004.  PubMed DOI:10.1101/gr.2596504
  • Fife B.T., Pauken K.E. (2011). The role of the PD-1 pathway in autoimmunity and peripheral tolerance.. Ann. N. Y. Acad. Sci. 1217: 45 — 59.  PubMed DOI:10.1111/j.1749-6632.2010.05919.x

Примітки

  1. HUGO Gene Nomenclature Commitee, HGNC:8760 (англ.). Процитовано 28 серпня 2017. 
  2. UniProt, Q15116 (англ.). Процитовано 28 серпня 2017. 
  3. Induced expression of PD-1, a novel member of the immunoglobulin gene superfamily, upon programmed cell death. The EMBO Journal 11 (11): 3887–95. November 1992. PMC 556898. PMID 1396582. doi:10.1002/j.1460-2075.1992.tb05481.x.  Проігноровано невідомий параметр |vauthors= (довідка)
  4. а б The PD1:PD-L1/2 Pathway from Discovery to Clinical Implementation. Frontiers in Immunology 7: 550. 2016. PMC 5149523. PMID 28018338. doi:10.3389/fimmu.2016.00550.  Проігноровано невідомий параметр |vauthors= (довідка)

Див. також