PTPRC

Матеріал з Вікіпедії — вільної енциклопедії.
Версія від 16:03, 6 січня 2020, створена SergoBot (обговорення | внесок)
(різн.) ← Попередня версія | Поточна версія (різн.) | Новіша версія → (різн.)
Перейти до навігації Перейти до пошуку
PTPRC
Ідентифікатори
Символи T200PTPRCprotein tyrosine phosphatasereceptor typec polypeptideT200 glycoproteinreceptor-type tyrosine-protein phosphatase CCD45 antigenLeukocyte common antigenT200 leukocyte common antigenL-CA
Зовнішні ІД GeneCards: [1]
Шаблон експресії
PBB GE PTPRC 212588 at fs.png
Більше даних
Ортологи
Види Людина Миша
Entrez
Ensembl
UniProt
RefSeq (мРНК)
н/д
н/д
RefSeq (білок)
н/д
н/д
Локус (UCSC) н/д н/д
PubMed search н/д н/д
Вікідані
Див./Ред. для людей

PTPRC (англ. Protein tyrosine phosphatase, receptor type C) – білок, який кодується однойменним геном, розташованим у людей на короткому плечі 1-ї хромосоми. [1] Довжина поліпептидного ланцюга білка становить 1 304 амінокислот, а молекулярна маса — 147 254[2].

Послідовність амінокислот
1020304050
MYLWLKLLAFGFAFLDTEVFVTGQSPTPSPTGLTTAKMPSVPLSSDPLPT
HTTAFSPASTFERENDFSETTTSLSPDNTSTQVSPDSLDNASAFNTTGVS
SVQTPHLPTHADSQTPSAGTDTQTFSGSAANAKLNPTPGSNAISDVPGER
STASTFPTDPVSPLTTTLSLAHHSSAALPARTSNTTITANTSDAYLNASE
TTTLSPSGSAVISTTTIATTPSKPTCDEKYANITVDYLYNKETKLFTAKL
NVNENVECGNNTCTNNEVHNLTECKNASVSISHNSCTAPDKTLILDVPPG
VEKFQLHDCTQVEKADTTICLKWKNIETFTCDTQNITYRFQCGNMIFDNK
EIKLENLEPEHEYKCDSEILYNNHKFTNASKIIKTDFGSPGEPQIIFCRS
EAAHQGVITWNPPQRSFHNFTLCYIKETEKDCLNLDKNLIKYDLQNLKPY
TKYVLSLHAYIIAKVQRNGSAAMCHFTTKSAPPSQVWNMTVSMTSDNSMH
VKCRPPRDRNGPHERYHLEVEAGNTLVRNESHKNCDFRVKDLQYSTDYTF
KAYFHNGDYPGEPFILHHSTSYNSKALIAFLAFLIIVTSIALLVVLYKIY
DLHKKRSCNLDEQQELVERDDEKQLMNVEPIHADILLETYKRKIADEGRL
FLAEFQSIPRVFSKFPIKEARKPFNQNKNRYVDILPYDYNRVELSEINGD
AGSNYINASYIDGFKEPRKYIAAQGPRDETVDDFWRMIWEQKATVIVMVT
RCEEGNRNKCAEYWPSMEEGTRAFGDVVVKINQHKRCPDYIIQKLNIVNK
KEKATGREVTHIQFTSWPDHGVPEDPHLLLKLRRRVNAFSNFFSGPIVVH
CSAGVGRTGTYIGIDAMLEGLEAENKVDVYGYVVKLRRQRCLMVQVEAQY
ILIHQALVEYNQFGETEVNLSELHPYLHNMKKRDPPSEPSPLEAEFQRLP
SYRSWRTQHIGNQEENKSKNRNSNVIPYDYNRVPLKHELEMSKESEHDSD
ESSDDDSDSEEPSKYINASFIMSYWKPEVMIAAQGPLKETIGDFWQMIFQ
RKVKVIVMLTELKHGDQEICAQYWGEGKQTYGDIEVDLKDTDKSSTYTLR
VFELRHSKRKDSRTVYQYQYTNWSVEQLPAEPKELISMIQVVKQKLPQKN
SSEGNKHHKSTPLLIHCRDGSQQTGIFCALLNLLESAETEEVVDIFQVVK
ALRKARPGMVSTFEQYQFLYDVIASTYPAQNGQVKKNNHQEDKIEFDNEV
DKVKQDANCVNPLGAPEKLPEAKEQAEGSEPTSGTEGPEHSVNGPASPAL
NQGS

Кодований геном білок за функціями належить до гідролаз, протеїн-фосфатаз. Локалізований у мембрані.

Література[ред. | ред. код]

  • Streuli M., Hall L.R., Saga Y., Schlossman S.F., Saito H. (1987). Differential usage of three exons generates at least five different mRNAs encoding human leukocyte common antigens.. J. Exp. Med. 166: 1548 — 1566.  PubMed DOI:10.1084/jem.166.5.1548
  • Tsai A.Y.M., Streuli M., Saito H. (1989). Integrity of the exon 6 sequence is essential for tissue-specific alternative splicing of human leukocyte common antigen pre-mRNA.. Mol. Cell. Biol. 9: 4550 — 4555.  PubMed DOI:10.1128/MCB.9.10.4550
  • Charbonneau H., Tonks N.K., Walsh K.A., Fischer E.H. (1988). The leukocyte common antigen (CD45): a putative receptor-linked protein tyrosine phosphatase.. Proc. Natl. Acad. Sci. U.S.A. 85: 7182 — 7186.  PubMed DOI:10.1073/pnas.85.19.7182
  • Wu L., Fu J., Shen S.-H. (2002). SKAP55 coupled with CD45 positively regulates T-cell receptor-mediated gene transcription.. Mol. Cell. Biol. 22: 2673 — 2686.  PubMed DOI:10.1128/MCB.22.8.2673-2686.2002
  • Carrascal M., Ovelleiro D., Casas V., Gay M., Abian J. (2008). Phosphorylation analysis of primary human T lymphocytes using sequential IMAC and titanium oxide enrichment.. J. Proteome Res. 7: 5167 — 5176.  PubMed DOI:10.1021/pr800500r
  • Nam H.J., Poy F., Saito H., Frederick C.A. (2005). Structural basis for the function and regulation of the receptor protein tyrosine phosphatase CD45.. J. Exp. Med. 201: 441 — 452.  PubMed DOI:10.1084/jem.20041890

Примітки[ред. | ред. код]

  1. HUGO Gene Nomenclature Commitee, HGNC:9666 (англ.). Процитовано 21 серпня 2017. 
  2. UniProt, P08575 (англ.). Процитовано 21 серпня 2017. 

Див. також[ред. | ред. код]