Інозинмонофосфатдегідрогеназа-2

Матеріал з Вікіпедії — вільної енциклопедії.
Перейти до навігації Перейти до пошуку
Інозинмонофосфатдегідрогеназа-2
PDB 1b3o EBI.jpg
Наявні структури
PDBПошук ортологів: PDBe RCSB
Ідентифікатори
Символи IMPDH2, IMPD2, IMPDH-II, IMP (inosine 5'-monophosphate) dehydrogenase 2, inosine monophosphate dehydrogenase 2
Зовнішні ІД OMIM: 146691 MGI: 109367 HomoloGene: 48919 GeneCards: IMPDH2
Реагує на сполуку
mycophenolate mofetil, Мікофенолова кислота, Рибавірин, Тіогуанін[1]
Ортологи
Види Людина Миша
Entrez
Ensembl
UniProt
RefSeq (мРНК)
NM_000884
NM_011830
RefSeq (білок)
NP_000875
NP_035960
Локус (UCSC) Хр. 3: 49.02 – 49.03 Mb Хр. 9: 108.56 – 108.57 Mb
PubMed search [2] [3]
Вікідані
Див./Ред. для людейДив./Ред. для мишей

Інозинмонофосфатдегідрогеназа-2 (англ. Inosine monophosphate dehydrogenase 2) – білок, який кодується геном IMPDH2, розташованим у людей на короткому плечі 3-ї хромосоми. [4] Довжина поліпептидного ланцюга білка становить 514 амінокислот, а молекулярна маса — 55 805[5].

Послідовність амінокислот
1020304050
MADYLISGGTSYVPDDGLTAQQLFNCGDGLTYNDFLILPGYIDFTADQVD
LTSALTKKITLKTPLVSSPMDTVTEAGMAIAMALTGGIGFIHHNCTPEFQ
ANEVRKVKKYEQGFITDPVVLSPKDRVRDVFEAKARHGFCGIPITDTGRM
GSRLVGIISSRDIDFLKEEEHDCFLEEIMTKREDLVVAPAGITLKEANEI
LQRSKKGKLPIVNEDDELVAIIARTDLKKNRDYPLASKDAKKQLLCGAAI
GTHEDDKYRLDLLAQAGVDVVVLDSSQGNSIFQINMIKYIKDKYPNLQVI
GGNVVTAAQAKNLIDAGVDALRVGMGSGSICITQEVLACGRPQATAVYKV
SEYARRFGVPVIADGGIQNVGHIAKALALGASTVMMGSLLAATTEAPGEY
FFSDGIRLKKYRGMGSLDAMDKHLSSQNRYFSEADKIKVAQGVSGAVQDK
GSIHKFVPYLIAGIQHSCQDIGAKSLTQVRAMMYSGELKFEKRTSSAQVE
GGVHSLHSYEKRLF

Цей білок за функцією належить до оксидоредуктаз. Задіяний у таких біологічних процесах як біосинтез пуринів, біосинтез ГМФ. Білок має сайт для зв'язування з НАД, іонами металів, ДНК, РНК, калію. Локалізований у цитоплазмі, ядрі.

Література[ред. | ред. код]

  • Glesne D.A., Huberman E. (1994). Cloning and sequence of the human type II IMP dehydrogenase gene.. Biochem. Biophys. Res. Commun. 205: 537 — 544.  PubMed DOI:10.1006/bbrc.1994.2698
  • Zimmermann A.G., Spychala J., Mitchell B.S. (1995). Characterization of the human inosine-5'-monophosphate dehydrogenase type II gene.. J. Biol. Chem. 270: 6808 — 6814.  PubMed DOI:10.1074/jbc.270.12.6808
  • The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).. Genome Res. 14: 2121 — 2127. 2004.  PubMed DOI:10.1101/gr.2596504
  • Glesne D.A., Collart F.R., Varkony T., Drabkin H., Huberman E. (1993). Chromosomal localization and structure of the human type II IMP dehydrogenase gene.. Genomics 16: 274 — 277.  PubMed DOI:10.1006/geno.1993.1177
  • Hager P.W., Collart F.R., Huberman E., Mitchell B.S. (1995). Recombinant human inosine monophosphate dehydrogenase type I and type II proteins. Purification and characterization of inhibitor binding.. Biochem. Pharmacol. 49: 1323 — 1329.  PubMed DOI:10.1016/0006-2952(95)00026-V
  • Colby T.D., Vanderveen K., Strickler M.D., Markham G.D., Goldstein B.M. (1999). Crystal structure of human type II inosine monophosphate dehydrogenase: implications for ligand binding and drug design.. Proc. Natl. Acad. Sci. U.S.A. 96: 3531 — 3536.  PubMed DOI:10.1073/pnas.96.7.3531

Примітки[ред. | ред. код]

Див. також[ред. | ред. код]