Інсуліноподібний фактор росту 1

Матеріал з Вікіпедії — вільної енциклопедії.
Перейти до навігації Перейти до пошуку
Інсуліноподібний фактор росту 1
Protein IGF1 PDB 1bqt.png
Наявні структури
PDBПошук ортологів: PDBe RCSB
Ідентифікатори
Символи IGF1, IGF-I, IGF1A, IGFI, MGF, insulin like growth factor 1, IGF
Зовнішні ІД OMIM: 147440 HomoloGene: 515 GeneCards: IGF1
Пов'язані генетичні захворювання
growth delay due to insulin-like growth factor type 1 deficiency[1]
Шаблон експресії
PBB GE IGF1 209540 at.png

PBB GE IGF1 209541 at.png

PBB GE IGF1 209542 x at.png
Більше даних
Ортологи
Види Людина Миша
Entrez
Ensembl
UniProt
RefSeq (мРНК)
NM_000618
NM_001111283
NM_001111284
NM_001111285
NM_001082477
NM_001082478
NM_001082479
NM_178866
RefSeq (білок)
NP_000609
NP_001104753
NP_001104754
NP_001104755
NP_001075946
NP_001075947
NP_001075948
NP_849197
Локус (UCSC) Хр. 12: 102.4 – 102.48 Mb н/д
PubMed search [2] [3]
Вікідані
Див./Ред. для людейДив./Ред. для мишей

Інсуліноподібний фактор росту 1 (ІФР-1, англ. Insulin like growth factor, 1 IGF-1) або соматомедін C – білок, який кодується геном IGF1, розташованим у людей на довгому плечі 12-ї хромосоми.[4] Довжина поліпептидного ланцюга білка становить 195 амінокислот, а молекулярна маса — 21 841[5]. Поліпептидний фактор росту, подібний за структурою до інсуліну.[6] Він здійснює ендокринну, автокринну і паракринну регуляцію процесів росту і розвитку і грає важливу роль в рості дитини та має анаболічний ефект в дорослих.

Див. також[ред. | ред. код]

Примітки[ред. | ред. код]

  1. Захворювання, генетично пов'язані з Інсуліноподібний фактор росту 1 переглянути/редагувати посилання на ВікіДаних. 
  2. Human PubMed Reference:. 
  3. Mouse PubMed Reference:. 
  4. HUGO Gene Nomenclature Commitee, HGNC:5464 (англ.). Архів оригіналу за 26 січня 2018. Процитовано 12 січня 2018. 
  5. UniProt, P05019 (англ.). Архів оригіналу за 13 січня 2018. Процитовано 12 січня 2018. 
  6. Melmed, S; Polonsky, KS; Larsen, PR; Kronenberg, HM (2011). Williams Textbook of Endocrinology (вид. 11th). Saunders. с. 478–479. ISBN 978-1416029113. 

Література[ред. | ред. код]



Послідовність амінокислот
1020304050
MGKISSLPTQLFKCCFCDFLKVKMHTMSSSHLFYLALCLLTFTSSATAGP
ETLCGAELVDALQFVCGDRGFYFNKPTGYGSSSRRAPQTGIVDECCFRSC
DLRRLEMYCAPLKPAKSARSVRAQRHTDMPKTQKYQPPSTNKNTKSQRRK
GWPKTHPGGEQKEGTEASLQIRGKKKEQRREIGSRNAECRGKKGK