Інтегрин, ізоформа бета-3

Матеріал з Вікіпедії — вільної енциклопедії.
Перейти до навігації Перейти до пошуку
Інтегрин, ізоформа бета-3
Ідентифікатори
Символи antigen CD61ITGB3GPIIIaintegrinbeta 3 (platelet glycoprotein IIIaantigen CD61)integrin beta chainbeta 3integrin beta-3integrin beta 3platelet membrane glycoprotein IIIa
Зовнішні ІД GeneCards: [1]
Шаблон експресії
PBB GE ITGB3 204628 s at fs.png
Більше даних
Ортологи
Види Людина Миша
Entrez
Ensembl
UniProt
RefSeq (мРНК)
н/д
н/д
RefSeq (білок)
н/д
н/д
Локус (UCSC) н/д н/д
PubMed search н/д н/д
Вікідані
Див./Ред. для людей

Інтегрин, ізоформа бета-3 (англ. Integrin subunit beta 3) – білок, який кодується геном ITGB3, розташованим у людей на короткому плечі 17-ї хромосоми. [1] Довжина поліпептидного ланцюга білка становить 788 амінокислот, а молекулярна маса — 87 058[2].

Послідовність амінокислот
1020304050
MRARPRPRPLWATVLALGALAGVGVGGPNICTTRGVSSCQQCLAVSPMCA
WCSDEALPLGSPRCDLKENLLKDNCAPESIEFPVSEARVLEDRPLSDKGS
GDSSQVTQVSPQRIALRLRPDDSKNFSIQVRQVEDYPVDIYYLMDLSYSM
KDDLWSIQNLGTKLATQMRKLTSNLRIGFGAFVDKPVSPYMYISPPEALE
NPCYDMKTTCLPMFGYKHVLTLTDQVTRFNEEVKKQSVSRNRDAPEGGFD
AIMQATVCDEKIGWRNDASHLLVFTTDAKTHIALDGRLAGIVQPNDGQCH
VGSDNHYSASTTMDYPSLGLMTEKLSQKNINLIFAVTENVVNLYQNYSEL
IPGTTVGVLSMDSSNVLQLIVDAYGKIRSKVELEVRDLPEELSLSFNATC
LNNEVIPGLKSCMGLKIGDTVSFSIEAKVRGCPQEKEKSFTIKPVGFKDS
LIVQVTFDCDCACQAQAEPNSHRCNNGNGTFECGVCRCGPGWLGSQCECS
EEDYRPSQQDECSPREGQPVCSQRGECLCGQCVCHSSDFGKITGKYCECD
DFSCVRYKGEMCSGHGQCSCGDCLCDSDWTGYYCNCTTRTDTCMSSNGLL
CSGRGKCECGSCVCIQPGSYGDTCEKCPTCPDACTFKKECVECKKFDRGA
LHDENTCNRYCRDEIESVKELKDTGKDAVNCTYKNEDDCVVRFQYYEDSS
GKSILYVVEEPECPKGPDILVVLLSVMGAILLIGLAALLIWKLLITIHDR
KEFAKFEEERARAKWDTANNPLYKEATSTFTNITYRGT

Цей білок за функціями належить до рецепторів клітини-хазяїна для входу віруса, рецепторів, інтегринів. Задіяний у таких біологічних процесах як клітинна адгезія, взаємодія хазяїн-вірус. Локалізований у клітинній мембрані, мембрані, клітинних контактах, клітинних відростках.

Література[ред. | ред. код]

  • The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).. Genome Res. 14: 2121 — 2127. 2004.  PubMed DOI:10.1101/gr.2596504
  • Catimel B., Parmentier S., Leung L.L., McGregor J.L. (1991). Separation of important new platelet glycoproteins (GPIa, GPIc, GPIc*, GPIIa and GMP-140) by F.P.L.C. Characterization by monoclonal antibodies and gas-phase sequencing.. Biochem. J. 279: 419 — 425.  PubMed DOI:10.1042/bj2790419
  • Van Kuppevelt T.H.M.S.M., Languino L.R., Gailit J.O., Suzuki S., Ruoslahti E. (1989). An alternative cytoplasmic domain of the integrin beta 3 subunit.. Proc. Natl. Acad. Sci. U.S.A. 86: 5415 — 5418.  PubMed DOI:10.1073/pnas.86.14.5415
  • Calvete J.J., Henschen A., Gonzalez-Rodriguez J. (1991). Assignment of disulphide bonds in human platelet GPIIIa. A disulphide pattern for the beta-subunits of the integrin family.. Biochem. J. 274: 63 — 71.  PubMed DOI:10.1042/bj2740063
  • Law D.A., Nannizzi-Alaimo L., Phillips D.R. (1996). Outside-in integrin signal transduction. Alpha IIb beta 3-(GP IIb IIIa) tyrosine phosphorylation induced by platelet aggregation.. J. Biol. Chem. 271: 10811 — 10815.  PubMed DOI:10.1074/jbc.271.18.10811
  • Gavrilovskaya I.N., Shepley M., Shaw R., Ginsberg M.H., Mackow E.R. (1998). beta3 Integrins mediate the cellular entry of hantaviruses that cause respiratory failure.. Proc. Natl. Acad. Sci. U.S.A. 95: 7074 — 7079.  PubMed DOI:10.1073/pnas.95.12.7074

Примітки[ред. | ред. код]

  1. HUGO Gene Nomenclature Commitee, HGNC:6156 (англ.). Процитовано 30 січня 2017. 
  2. UniProt, P05106 (англ.). Процитовано 30 січня 2017. 

Див. також[ред. | ред. код]