Бета-катенін

Матеріал з Вікіпедії — вільної енциклопедії.
Перейти до навігації Перейти до пошуку
Catenin beta 1
Ідентифікатори
Символи catenin beta-1CTNNB1catenin (cadherin-associated protein)beta 188kDaBeta-catenin
Зовнішні ІД GeneCards: [1]
Ортологи
Види Людина Миша
Entrez
Ensembl
UniProt
RefSeq (мРНК)
н/д
н/д
RefSeq (білок)
н/д
н/д
Локус (UCSC) н/д н/д
PubMed search н/д н/д
Вікідані
Див./Ред. для людей

CTNNB1 (англ. Catenin beta 1) – білок, який кодується однойменним геном, розташованим у людей на короткому плечі 3-ї хромосоми. [1] Довжина поліпептидного ланцюга білка становить 781 амінокислот, а молекулярна маса — 85 497[2].

Послідовність амінокислот
1020304050
MATQADLMELDMAMEPDRKAAVSHWQQQSYLDSGIHSGATTTAPSLSGKG
NPEEEDVDTSQVLYEWEQGFSQSFTQEQVADIDGQYAMTRAQRVRAAMFP
ETLDEGMQIPSTQFDAAHPTNVQRLAEPSQMLKHAVVNLINYQDDAELAT
RAIPELTKLLNDEDQVVVNKAAVMVHQLSKKEASRHAIMRSPQMVSAIVR
TMQNTNDVETARCTAGTLHNLSHHREGLLAIFKSGGIPALVKMLGSPVDS
VLFYAITTLHNLLLHQEGAKMAVRLAGGLQKMVALLNKTNVKFLAITTDC
LQILAYGNQESKLIILASGGPQALVNIMRTYTYEKLLWTTSRVLKVLSVC
SSNKPAIVEAGGMQALGLHLTDPSQRLVQNCLWTLRNLSDAATKQEGMEG
LLGTLVQLLGSDDINVVTCAAGILSNLTCNNYKNKMMVCQVGGIEALVRT
VLRAGDREDITEPAICALRHLTSRHQEAEMAQNAVRLHYGLPVVVKLLHP
PSHWPLIKATVGLIRNLALCPANHAPLREQGAIPRLVQLLVRAHQDTQRR
TSMGGTQQQFVEGVRMEEIVEGCTGALHILARDVHNRIVIRGLNTIPLFV
QLLYSPIENIQRVAAGVLCELAQDKEAAEAIEAEGATAPLTELLHSRNEG
VATYAAAVLFRMSEDKPQDYKKRLSVELTSSLFRTEPMAWNETADLGLDI
GAQGEPLGYRQDDPSYRSFHSGGYGQDALGMDPMMEHEMGGHHPGADYPV
DGLPDLGHAQDLMDGLPPGDSNQLAWFDTDL

Кодований геном білок за функціями належить до активаторів, фосфопротеїнів. Задіяний у таких біологічних процесах як клітинна адгезія, транскрипція, регуляція транскрипції, нейрогенез, сигнальний шлях Wnt, поліморфізм, ацетиляція, альтернативний сплайсинг. Локалізований у клітинній мембрані, цитоплазмі, цитоскелеті, ядрі, мембрані, клітинних контактах, синапсах.

Література[ред. | ред. код]

  • Huelsken J., Birchmeier W., Behrens J. (1994). E-cadherin and APC compete for the interaction with beta-catenin and the cytoskeleton.. J. Cell Biol. 127: 2061 — 2069.  PubMed DOI:10.1083/jcb.127.6.2061
  • The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).. Genome Res. 14: 2121 — 2127. 2004.  PubMed DOI:10.1101/gr.2596504
  • Butz S., Kemler R. (1994). Distinct cadherin-catenin complexes in Ca(2+)-dependent cell-cell adhesion.. FEBS Lett. 355: 195 — 200.  PubMed DOI:10.1016/0014-5793(94)01205-9
  • Mueller T., Choidas A., Reichmann E., Ullrich A. (1999). Phosphorylation and free pool of beta-catenin are regulated by tyrosine kinases and tyrosine phosphatases during epithelial cell migration.. J. Biol. Chem. 274: 10173 — 10183.  PubMed DOI:10.1074/jbc.274.15.10173
  • Moreno-Bueno G., Gamallo C., Perez-Gallego L., Contreras F., Palacios J. (2001). Beta-catenin expression in pilomatrixomas. Relationship with beta-catenin gene mutations and comparison with beta-catenin expression in normal hair follicles.. Br. J. Dermatol. 145: 576 — 581.  PubMed DOI:10.1046/j.1365-2133.2001.04455.x
  • Tutter A.V., Fryer C.J., Jones K.A. (2001). Chromatin-specific regulation of LEF-1-beta-catenin transcription activation and inhibition in vitro.. Genes Dev. 15: 3342 — 3354.  PubMed DOI:10.1101/gad.946501

Примітки[ред. | ред. код]

  1. HUGO Gene Nomenclature Commitee, HGNC:2514 (англ.). Процитовано 30 серпня 2017. 
  2. UniProt, P35222 (англ.). Процитовано 30 серпня 2017. 

Див. також[ред. | ред. код]