Біглікан

Матеріал з Вікіпедії — вільної енциклопедії.
Перейти до навігації Перейти до пошуку
Біглікан
Protein BGN PDB 2ft3.png
Ідентифікатори
Символи BGN, DSPG1, PG-S1, PGI, SLRR1A, biglycan, SEMDX, MRLS
Зовнішні ІД OMIM: 301870 MGI: 88158 HomoloGene: 1293 GeneCards: BGN
Пов'язані генетичні захворювання
X-linked spondyloepimetaphyseal dysplasia[1]
Шаблон експресії
PBB GE BGN 213905 x at fs.png

PBB GE BGN 201262 s at fs.png

PBB GE BGN 201261 x at fs.png
Більше даних
Ортологи
Види Людина Миша
Entrez
Ensembl
UniProt
RefSeq (мРНК)
NM_001711
NM_007542
RefSeq (білок)
NP_001702
NP_031568
Локус (UCSC) Хр. X: 153.49 – 153.51 Mb Хр. X: 73.48 – 73.5 Mb
PubMed search [2] [3]
Вікідані
Див./Ред. для людейДив./Ред. для мишей

Біглікан (англ. Biglycan) – білок, який кодується геном BGN, розташованим у людей на короткому плечі X-хромосоми. [4] Довжина поліпептидного ланцюга білка становить 368 амінокислот, а молекулярна маса — 41 654[5].

Послідовність амінокислот
1020304050
MWPLWRLVSLLALSQALPFEQRGFWDFTLDDGPFMMNDEEASGADTSGVL
DPDSVTPTYSAMCPFGCHCHLRVVQCSDLGLKSVPKEISPDTTLLDLQNN
DISELRKDDFKGLQHLYALVLVNNKISKIHEKAFSPLRKLQKLYISKNHL
VEIPPNLPSSLVELRIHDNRIRKVPKGVFSGLRNMNCIEMGGNPLENSGF
EPGAFDGLKLNYLRISEAKLTGIPKDLPETLNELHLDHNKIQAIELEDLL
RYSKLYRLGLGHNQIRMIENGSLSFLPTLRELHLDNNKLARVPSGLPDLK
LLQVVYLHSNNITKVGVNDFCPMGFGVKRAYYNGISLFNNPVPYWEVQPA
TFRCVTDRLAIQFGNYKK

Локалізований у позаклітинному матриксі. Також секретований назовні.

Література[ред. | ред. код]

  • The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).. Genome Res. 14: 2121 — 2127. 2004.  PubMed DOI:10.1101/gr.2596504
  • Roughley P.J., White R.J. (1989). Dermatan sulphate proteoglycans of human articular cartilage. The properties of dermatan sulphate proteoglycans I and II.. Biochem. J. 262: 823 — 827.  PubMed DOI:10.1042/bj2620823
  • Just W., Rau W., Muller R., Geerkens C., Vogel W. (1994). Dinucleotide repeat polymorphism at the human biglycan (BGN) locus.. Hum. Mol. Genet. 3: 2268 — 2268.  PubMed DOI:10.1093/hmg/3.12.2268
  • Fisher L.W., Termine J.D., Young M.F. (1989). Deduced protein sequence of bone small proteoglycan I (biglycan) shows homology with proteoglycan II (decorin) and several nonconnective tissue proteins in a variety of species.. J. Biol. Chem. 264: 4571 — 4576.  PubMed
  • Fisher L.W., Hawkins G.R., Tuross N., Termine J.D. (1987). Purification and partial characterization of small proteoglycans I and II, bone sialoproteins I and II, and osteonectin from the mineral compartment of developing human bone.. J. Biol. Chem. 262: 9702 — 9708.  PubMed

Примітки[ред. | ред. код]

Див. також[ред. | ред. код]