Гантінгтін

Матеріал з Вікіпедії — вільної енциклопедії.
Перейти до навігації Перейти до пошуку
HTT
PDB 3io4 EBI.png
Наявні структури
PDBПошук ортологів: PDBe RCSB
Ідентифікатори
Символи HTT, HD, IT15, huntingtin, LOMARS
Зовнішні ІД OMIM: 613004 MGI: 96067 HomoloGene: 1593 GeneCards: HTT
Шаблон експресії
PBB GE HD 202389 s at fs.png
Більше даних
Ортологи
Види Людина Миша
Entrez
Ensembl
UniProt
RefSeq (мРНК)
NM_002111
NM_010414
RefSeq (білок)
NP_002102
NP_034544
Локус (UCSC) Хр. 4: 3.07 – 3.24 Mb Хр. 5: 34.76 – 34.91 Mb
PubMed search [1] [2]
Вікідані
Див./Ред. для людейДив./Ред. для мишей

HTT (англ. Huntingtin) – білок, який кодується однойменним геном, розташованим у людей на короткому плечі 4-ї хромосоми. [3] Довжина поліпептидного ланцюга білка становить 3 142 амінокислот, а молекулярна маса — 347 603[4]. Мутація в цьому гені спричиняє хворобу Гантінгтона.

Послідовність амінокислот
1020304050
MATLEKLMKAFESLKSFQQQQQQQQQQQQQQQQQQQQQPPPPPPPPPPPQ
LPQPPPQAQPLLPQPQPPPPPPPPPPGPAVAEEPLHRPKKELSATKKDRV
NHCLTICENIVAQSVRNSPEFQKLLGIAMELFLLCSDDAESDVRMVADEC
LNKVIKALMDSNLPRLQLELYKEIKKNGAPRSLRAALWRFAELAHLVRPQ
KCRPYLVNLLPCLTRTSKRPEESVQETLAAAVPKIMASFGNFANDNEIKV
LLKAFIANLKSSSPTIRRTAAGSAVSICQHSRRTQYFYSWLLNVLLGLLV
PVEDEHSTLLILGVLLTLRYLVPLLQQQVKDTSLKGSFGVTRKEMEVSPS
AEQLVQVYELTLHHTQHQDHNVVTGALELLQQLFRTPPPELLQTLTAVGG
IGQLTAAKEESGGRSRSGSIVELIAGGGSSCSPVLSRKQKGKVLLGEEEA
LEDDSESRSDVSSSALTASVKDEISGELAASSGVSTPGSAGHDIITEQPR
SQHTLQADSVDLASCDLTSSATDGDEEDILSHSSSQVSAVPSDPAMDLND
GTQASSPISDSSQTTTEGPDSAVTPSDSSEIVLDGTDNQYLGLQIGQPQD
EDEEATGILPDEASEAFRNSSMALQQAHLLKNMSHCRQPSDSSVDKFVLR
DEATEPGDQENKPCRIKGDIGQSTDDDSAPLVHCVRLLSASFLLTGGKNV
LVPDRDVRVSVKALALSCVGAAVALHPESFFSKLYKVPLDTTEYPEEQYV
SDILNYIDHGDPQVRGATAILCGTLICSILSRSRFHVGDWMGTIRTLTGN
TFSLADCIPLLRKTLKDESSVTCKLACTAVRNCVMSLCSSSYSELGLQLI
IDVLTLRNSSYWLVRTELLETLAEIDFRLVSFLEAKAENLHRGAHHYTGL
LKLQERVLNNVVIHLLGDEDPRVRHVAAASLIRLVPKLFYKCDQGQADPV
VAVARDQSSVYLKLLMHETQPPSHFSVSTITRIYRGYNLLPSITDVTMEN
NLSRVIAAVSHELITSTTRALTFGCCEALCLLSTAFPVCIWSLGWHCGVP
PLSASDESRKSCTVGMATMILTLLSSAWFPLDLSAHQDALILAGNLLAAS
APKSLRSSWASEEEANPAATKQEEVWPALGDRALVPMVEQLFSHLLKVIN
ICAHVLDDVAPGPAIKAALPSLTNPPSLSPIRRKGKEKEPGEQASVPLSP
KKGSEASAASRQSDTSGPVTTSKSSSLGSFYHLPSYLKLHDVLKATHANY
KVTLDLQNSTEKFGGFLRSALDVLSQILELATLQDIGKCVEEILGYLKSC
FSREPMMATVCVQQLLKTLFGTNLASQFDGLSSNPSKSQGRAQRLGSSSV
RPGLYHYCFMAPYTHFTQALADASLRNMVQAEQENDTSGWFDVLQKVSTQ
LKTNLTSVTKNRADKNAIHNHIRLFEPLVIKALKQYTTTTCVQLQKQVLD
LLAQLVQLRVNYCLLDSDQVFIGFVLKQFEYIEVGQFRESEAIIPNIFFF
LVLLSYERYHSKQIIGIPKIIQLCDGIMASGRKAVTHAIPALQPIVHDLF
VLRGTNKADAGKELETQKEVVVSMLLRLIQYHQVLEMFILVLQQCHKENE
DKWKRLSRQIADIILPMLAKQQMHIDSHEALGVLNTLFEILAPSSLRPVD
MLLRSMFVTPNTMASVSTVQLWISGILAILRVLISQSTEDIVLSRIQELS
FSPYLISCTVINRLRDGDSTSTLEEHSEGKQIKNLPEETFSRFLLQLVGI
LLEDIVTKQLKVEMSEQQHTFYCQELGTLLMCLIHIFKSGMFRRITAAAT
RLFRSDGCGGSFYTLDSLNLRARSMITTHPALVLLWCQILLLVNHTDYRW
WAEVQQTPKRHSLSSTKLLSPQMSGEEEDSDLAAKLGMCNREIVRRGALI
LFCDYVCQNLHDSEHLTWLIVNHIQDLISLSHEPPVQDFISAVHRNSAAS
GLFIQAIQSRCENLSTPTMLKKTLQCLEGIHLSQSGAVLTLYVDRLLCTP
FRVLARMVDILACRRVEMLLAANLQSSMAQLPMEELNRIQEYLQSSGLAQ
RHQRLYSLLDRFRLSTMQDSLSPSPPVSSHPLDGDGHVSLETVSPDKDWY
VHLVKSQCWTRSDSALLEGAELVNRIPAEDMNAFMMNSEFNLSLLAPCLS
LGMSEISGGQKSALFEAAREVTLARVSGTVQQLPAVHHVFQPELPAEPAA
YWSKLNDLFGDAALYQSLPTLARALAQYLVVVSKLPSHLHLPPEKEKDIV
KFVVATLEALSWHLIHEQIPLSLDLQAGLDCCCLALQLPGLWSVVSSTEF
VTHACSLIYCVHFILEAVAVQPGEQLLSPERRTNTPKAISEEEEEVDPNT
QNPKYITAACEMVAEMVESLQSVLALGHKRNSGVPAFLTPLLRNIIISLA
RLPLVNSYTRVPPLVWKLGWSPKPGGDFGTAFPEIPVEFLQEKEVFKEFI
YRINTLGWTSRTQFEETWATLLGVLVTQPLVMEQEESPPEEDTERTQINV
LAVQAITSLVLSAMTVPVAGNPAVSCLEQQPRNKPLKALDTRFGRKLSII
RGIVEQEIQAMVSKRENIATHHLYQAWDPVPSLSPATTGALISHEKLLLQ
INPERELGSMSYKLGQVSIHSVWLGNSITPLREEEWDEEEEEEADAPAPS
SPPTSPVNSRKHRAGVDIHSCSQFLLELYSRWILPSSSARRTPAILISEV
VRSLLVVSDLFTERNQFELMYVTLTELRRVHPSEDEILAQYLVPATCKAA
AVLGMDKAVAEPVSRLLESTLRSSHLPSRVGALHGVLYVLECDLLDDTAK
QLIPVISDYLLSNLKGIAHCVNIHSQQHVLVMCATAFYLIENYPLDVGPE
FSASIIQMCGVMLSGSEESTPSIIYHCALRGLERLLLSEQLSRLDAESLV
KLSVDRVNVHSPHRAMAALGLMLTCMYTGKEKVSPGRTSDPNPAAPDSES
VIVAMERVSVLFDRIRKGFPCEARVVARILPQFLDDFFPPQDIMNKVIGE
FLSNQQPYPQFMATVVYKVFQTLHSTGQSSMVRDWVMLSLSNFTQRAPVA
MATWSLSCFFVSASTSPWVAAILPHVISRMGKLEQVDVNLFCLVATDFYR
HQIEEELDRRAFQSVLEVVAAPGSPYHRLLTCLRNVHKVTTC

Кодований геном білок за функцією належить до фосфопротеїнів. Задіяний у таких біологічних процесах як апоптоз, поліморфізм, ацетиляція. Локалізований у цитоплазмі, ядрі.

Література[ред. | ред. код]

  • Xia J., Lee D.H., Taylor J., Vandelft M., Truant R. (2003). Huntingtin contains a highly conserved nuclear export signal.. Hum. Mol. Genet. 12: 1393 — 1403.  PubMed DOI:10.1093/hmg/ddg156
  • Sayer J.A., Manczak M., Akileswaran L., Reddy P.H., Coghlan V.M. (2005). Interaction of the nuclear matrix protein NAKAP with HypA and huntingtin: implications for nuclear toxicity in Huntington's disease pathogenesis.. NeuroMolecular Med. 7: 297 — 310.  PubMed DOI:10.1385/NMM:7:4:297
  • Anne S.L., Saudou F., Humbert S. (2007). Phosphorylation of huntingtin by cyclin-dependent kinase 5 is induced by DNA damage and regulates wild-type and mutant huntingtin toxicity in neurons.. J. Neurosci. 27: 7318 — 7328.  PubMed DOI:10.1523/JNEUROSCI.1831-07.2007
  • Shao J., Welch W.J., Diprospero N.A., Diamond M.I. (2008). Phosphorylation of profilin by ROCK1 regulates polyglutamine aggregation.. Mol. Cell. Biol. 28: 5196 — 5208.  PubMed DOI:10.1128/MCB.00079-08
  • Lemonidis K., Sanchez-Perez M.C., Chamberlain L.H. (2015). Identification of a novel sequence motif recognized by the ankyrin repeat domain of zDHHC17/13 S-acyltransferases.. J. Biol. Chem. 290: 21939 — 21950.  PubMed DOI:10.1074/jbc.M115.657668
  • Kim M.W., Chelliah Y., Kim S.W., Otwinowski Z., Bezprozvanny I. (2009). Secondary structure of Huntingtin amino-terminal region.. Structure 17: 1205 — 1212.  PubMed DOI:10.1016/j.str.2009.08.002

Примітки[ред. | ред. код]

  1. Human PubMed Reference:. 
  2. Mouse PubMed Reference:. 
  3. HUGO Gene Nomenclature Commitee, HGNC:4851 (англ.). Процитовано 30 серпня 2017. 
  4. UniProt, P42858 (англ.). Процитовано 30 серпня 2017. 

Див. також[ред. | ред. код]