Глутарил-КоА-дегідрогеназа

Матеріал з Вікіпедії — вільної енциклопедії.
Перейти до навігації Перейти до пошуку
Глутарил-КоА-дегідрогеназа
Наявні структури
PDBПошук ортологів: PDBe RCSB
Ідентифікатори
Символи GCDH, ACAD5, GCD, glutaryl-CoA dehydrogenase, Glutaryl-Coenzyme A dehydrogenase
Зовнішні ІД OMIM: 608801 MGI: 104541 HomoloGene: 130 GeneCards: GCDH
Пов'язані генетичні захворювання
glutaric aciduria type 1[1]
Ортологи
Види Людина Миша
Entrez
Ensembl
UniProt
RefSeq (мРНК)
NM_000159
NM_013976
NM_001044744
NM_008097
RefSeq (білок)
NP_000150
NP_039663
NP_001038209
NP_032123
Локус (UCSC) Хр. 19: 12.89 – 12.91 Mb Хр. 8: 84.89 – 84.89 Mb
PubMed search [2] [3]
Вікідані
Див./Ред. для людейДив./Ред. для мишей

Глутарил-КоА-дегідрогеназа (англ. Glutaryl-CoA dehydrogenase) – білок, який кодується геном GCDH, розташованим у людей на короткому плечі 19-ї хромосоми.[4] Довжина поліпептидного ланцюга білка становить 438 амінокислот, а молекулярна маса — 48 127[5].

Послідовність амінокислот
1020304050
MALRGVSVRLLSRGPGLHVLRTWVSSAAQTEKGGRTQSQLAKSSRPEFDW
QDPLVLEEQLTTDEILIRDTFRTYCQERLMPRILLANRNEVFHREIISEM
GELGVLGPTIKGYGCAGVSSVAYGLLARELERVDSGYRSAMSVQSSLVMH
PIYAYGSEEQRQKYLPQLAKGELLGCFGLTEPNSGSDPSSMETRAHYNSS
NKSYTLNGTKTWITNSPMADLFVVWARCEDGCIRGFLLEKGMRGLSAPRI
QGKFSLRASATGMIIMDGVEVPEENVLPGASSLGGPFGCLNNARYGIAWG
VLGASEFCLHTARQYALDRMQFGVPLARNQLIQKKLADMLTEITLGLHAC
LQLGRLKDQDKAAPEMVSLLKRNNCGKALDIARQARDMLGGNGISDEYHV
IRHAMNLEAVNTYEGTHDIHALILGRAITGIQAFTASK

Цей білок за функцією належить до оксидоредуктаз. Задіяний у таких біологічних процесах, як ацетилювання, альтернативний сплайсинг. Білок має сайт для зв'язування з ФАД, флавопротеїном. Локалізований у мітохондрії.

Література[ред. | ред. код]

  • Schwartz M., Christensen E., Superti-Furga A., Brandt N.J. (1998). The human glutaryl-CoA dehydrogenase gene: report of intronic sequences and of 13 novel mutations causing glutaric aciduria type I.. Hum. Genet. 102: 452 — 458.  PubMed DOI:10.1007/s004390050720
  • The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).. Genome Res. 14: 2121 — 2127. 2004.  PubMed DOI:10.1101/gr.2596504
  • Hyman D.B., Tanaka K. (1984). Specific glutaryl-CoA dehydrogenating activity is deficient in cultured fibroblasts from glutaric aciduria patients.. J. Clin. Invest. 73: 778 — 784.  PubMed DOI:10.1172/JCI111271
  • Rao K.S., Albro M., Dwyer T.M., Frerman F.E. (2006). Kinetic mechanism of glutaryl-CoA dehydrogenase.. Biochemistry 45: 15853 — 15861.  PubMed DOI:10.1021/bi0609016
  • Goodman S.I., Kratz L.E., Frerman F.E. (1992). Pork and human cDNAs encoding glutaryl-CoA dehydrogenase.. Prog. Clin. Biol. Res. 375: 169 — 173.  PubMed
  • Biery B.J., Stein D.E., Morton D.H., Goodman S.I. (1996). Gene structure and mutations of glutaryl-coenzyme A dehydrogenase: impaired association of enzyme subunits that is due to an A421V substitution causes glutaric acidemia type I in the Amish.. Am. J. Hum. Genet. 59: 1006 — 1011.  PubMed

Примітки[ред. | ред. код]

Див. також[ред. | ред. код]