Глюкозозалежний інсулінотропний поліпептид

Матеріал з Вікіпедії — вільної енциклопедії.
Перейти до навігації Перейти до пошуку
Глюкозозалежний інсулінотропний поліпептид
Ідентифікатори
Символи incretin hormonegastric inhibitory polypeptideGIPglucose-dependent insulinotropic polypeptide
Зовнішні ІД GeneCards: [1]
Ортологи
Види Людина Миша
Entrez
Ensembl
UniProt
RefSeq (мРНК)
н/д
н/д
RefSeq (білок)
н/д
н/д
Локус (UCSC) н/д н/д
PubMed search н/д н/д
Вікідані
Див./Ред. для людей

Глюкозозалежний інсулінотропний поліпептид, також глюкозозалежний інсулінотропний пептид, глюкозозалежний інсулінотропний гормон, ГІП (англ. Gastric inhibitory polypeptide) – білок, який кодується геном GIP, розташованим у людей на довгому плечі 17-ї хромосоми.[1] Довжина поліпептидного ланцюга білка становить 153 амінокислот, а молекулярна маса — 17 108[2]. Це пептидний гормон, що виробляється K-клітинами слизової оболонки дванадцятипалої та проксимальної частини тонкої кишки. Відноситься до родини секретину.[3] [4]


Структура[ред. | ред. код]

Зрілий ГІП людини складається з 42 амінокислотних залишків: H-Tyr-Ala-Glu-Gly-Thr-Phe-lle-Ser-Asp-Tyr-Ser-lle-Ala-Met- Asp-Lys-lle-His-Gla-Glii-Asp-Phe-Val-Asn-Trp-Leu-Leu-Ala- GIn-Lys-Gly-Lys-Lys-Asn-Asp-Trp-Lys-His-Asii-lle-Thr-GiD-OH. Одна частина молекули ГІП збігається з молекулою секретину, інша — з молекулою глюкагону.

Функції[ред. | ред. код]

Глюкозозалежний інсулінотропний поліпептид є інкретином. Стимуляторами секреції ГІП є жири і вуглеводи, які надходять в тонку кишку після перевареної в шлунку їжі. Подібно до інших гормонів, ГІП транспортується кровотоком.

Основна функція глюкозозалежного інсулінотропного поліпептиду — стимуляція секреції інсуліну бета-клітинами підшлункової залози у відповідь на прийом їжі. Крім того, ГІП пригнічує абсорбцію жирів, пригнічує реабсорбцію натрію і води в травному тракті, гальмує ліпопротеїнліпазу.

Послідовність амінокислот
1020304050
MVATKTFALLLLSLFLAVGLGEKKEGHFSALPSLPVGSHAKVSSPQPRGP
RYAEGTFISDYSIAMDKIHQQDFVNWLLAQKGKKNDWKHNITQREARALE
LASQANRKEEEAVEPQSSPAKNPSDEDLLRDLLIQELLACLLDQTNLCRL
RSR

Література[ред. | ред. код]

  • The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).. Genome Res. 14: 2121 — 2127. 2004.  PubMed DOI:10.1101/gr.2596504
  • Moody A.J., Thim L., Valverde I. (1984). The isolation and sequencing of human gastric inhibitory peptide (GIP).. FEBS Lett. 172: 142 — 148.  PubMed DOI:10.1016/0014-5793(84)81114-X

Примітки[ред. | ред. код]

  1. HUGO Gene Nomenclature Commitee, HGNC:4270 (англ.). Процитовано 5 жовтня 2018. 
  2. UniProt, P09681 (англ.). Процитовано 5 жовтня 2018. 
  3. Єрмолова Ю. В. (2013-06-20). Можливості інкретинової терапії у лікуванні цукрового діабету 2-го типу. Український медичний часопис. Процитовано 2016-06-20. 
  4. Боднар П. М. Ендокринологія. 3 вид.: Підручник для ВМНЗ IV р.а.. Нова Книга. ISBN 978-966-382-479-6. 

Див. також[ред. | ред. код]