Кератин-10

Матеріал з Вікіпедії — вільної енциклопедії.
Перейти до навігації Перейти до пошуку
Кератин-10
Наявні структури
PDBПошук ортологів: PDBe RCSB
Ідентифікатори
Символи KRT10, BCIE, BIE, CK10, EHK, K10, KPP, keratin 10
Зовнішні ІД OMIM: 148080 MGI: 96685 GeneCards: KRT10
Пов'язані генетичні захворювання
epidermolytic hyperkeratosis[1]
Шаблон експресії
PBB GE KRT10 210633 x at fs.png

PBB GE KRT10 213287 s at fs.png

PBB GE KRT10 207023 x at fs.png
Більше даних
Ортологи
Види Людина Миша
Entrez
Ensembl
UniProt
RefSeq (мРНК)
NM_000421
NM_010660
RefSeq (білок)
NP_000412
NP_034790
Локус (UCSC) Хр. 17: 40.82 – 40.82 Mb Хр. 11: 99.39 – 99.39 Mb
PubMed search [2] [3]
Вікідані
Див./Ред. для людейДив./Ред. для мишей

Кератин-10 (англ. Keratin 10) – білок, який кодується геном KRT10, розташованим у людей на короткому плечі 17-ї хромосоми. [4] Довжина поліпептидного ланцюга білка становить 584 амінокислот, а молекулярна маса — 58 827[5]. Належить до великої родини кератинів — структурних білків цитоскелету.

Послідовність амінокислот
1020304050
MSVRYSSSKHYSSSRSGGGGGGGGCGGGGGVSSLRISSSKGSLGGGFSSG
GFSGGSFSRGSSGGGCFGGSSGGYGGLGGFGGGSFRGSYGSSSFGGSYGG
IFGGGSFGGGSFGGGSFGGGGFGGGGFGGGFGGGFGGDGGLLSGNEKVTM
QNLNDRLASYLDKVRALEESNYELEGKIKEWYEKHGNSHQGEPRDYSKYY
KTIDDLKNQILNLTTDNANILLQIDNARLAADDFRLKYENEVALRQSVEA
DINGLRRVLDELTLTKADLEMQIESLTEELAYLKKNHEEEMKDLRNVSTG
DVNVEMNAAPGVDLTQLLNNMRSQYEQLAEQNRKDAEAWFNEKSKELTTE
IDNNIEQISSYKSEITELRRNVQALEIELQSQLALKQSLEASLAETEGRY
CVQLSQIQAQISALEEQLQQIRAETECQNTEYQQLLDIKIRLENEIQTYR
SLLEGEGSSGGGGRGGGSFGGGYGGGSSGGGSSGGGHGGGHGGSSGGGYG
GGSSGGGSSGGGYGGGSSSGGHGGSSSGGYGGGSSGGGGGGYGGGSSGGG
SSSGGGYGGGSSSGGHKSSSSGSVGESSSKGPRY

Література[ред. | ред. код]

  • Rieger M., Franke W.W. (1988). Identification of an orthologous mammalian cytokeratin gene. High degree of intron sequence conservation during evolution of human cytokeratin 10.. J. Mol. Biol. 204: 841 — 856.  PubMed DOI:10.1016/0022-2836(88)90045-9
  • The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).. Genome Res. 14: 2121 — 2127. 2004.  PubMed DOI:10.1101/gr.2596504
  • Darmon M.Y., Semat A., Darmon M.C., Vasseur M. (1987). Sequence of a cDNA encoding human keratin No 10 selected according to structural homologies of keratins and their tissue-specific expression.. Mol. Biol. Rep. 12: 277 — 283.  PubMed DOI:10.1007/BF00444680
  • Rothnagel J.A., Longley M.A., Holder R.A., Kuster W., Roop D.R. (1994). Prenatal diagnosis of epidermolytic hyperkeratosis by direct gene sequencing.. J. Invest. Dermatol. 102: 13 — 16.  PubMed DOI:10.1111/1523-1747.ep12371723
  • Tkachenko A.V., Buchman V.L., Bliskovsky V.V., Shvets Y.P., Kisselev L.L. (1992). Exons I and VII of the gene (Ker10) encoding human keratin 10 undergo structural rearrangements within repeats.. Gene 116: 245 — 251.  PubMed DOI:10.1016/0378-1119(92)90521-P
  • Korge B.P., Gan S.-Q., McBridge O.W., Mischke D., Steinert P.M. (1992). Extensive size polymorphism of the human keratin 10 chain resides in the C-terminal V2 subdomain due to variable numbers and sizes of glycine loops.. Proc. Natl. Acad. Sci. U.S.A. 89: 910 — 914.  PubMed DOI:10.1073/pnas.89.3.910

Примітки[ред. | ред. код]

Див. також[ред. | ред. код]