Кератин-14

Матеріал з Вікіпедії — вільної енциклопедії.
Перейти до навігації Перейти до пошуку
Кератин-14
Наявні структури
PDBПошук ортологів: PDBe RCSB
Ідентифікатори
Символи KRT14, CK14, EBS3, EBS4, K14, NFJ, keratin 14
Зовнішні ІД OMIM: 148066 MGI: 96688 HomoloGene: 110439 GeneCards: KRT14
Пов'язані генетичні захворювання
epidermolysis bullosa herpetiformis, Localized epidermolysis bullosa simplex, Generalized epidermolysis bullosa simplex, Naegeli–Franceschetti–Jadassohn syndrome, dermatopathia pigmentosa reticularis[1]
Шаблон експресії
PBB GE KRT14 209351 at fs.png
Більше даних
Ортологи
Види Людина Миша
Entrez
Ensembl
UniProt
RefSeq (мРНК)
NM_000526
NM_016958
NM_001313956
NM_001313957
RefSeq (білок)
NP_000517
NP_001300885
NP_001300886
NP_058654
Локус (UCSC) Хр. 17: 41.58 – 41.59 Mb Хр. 11: 100.2 – 100.21 Mb
PubMed search [2] [3]
Вікідані
Див./Ред. для людейДив./Ред. для мишей

Кератин-14 (англ. Keratin 14) – білок, який кодується геном KRT14, розташованим у людей на короткому плечі 17-ї хромосоми. [4] Довжина поліпептидного ланцюга білка становить 472 амінокислот, а молекулярна маса — 51 561[5].

Належить до великої родини кератинів — структурних білків цитоскелету.

Послідовність амінокислот
1020304050
MTTCSRQFTSSSSMKGSCGIGGGIGGGSSRISSVLAGGSCRAPSTYGGGL
SVSSSRFSSGGACGLGGGYGGGFSSSSSSFGSGFGGGYGGGLGAGLGGGF
GGGFAGGDGLLVGSEKVTMQNLNDRLASYLDKVRALEEANADLEVKIRDW
YQRQRPAEIKDYSPYFKTIEDLRNKILTATVDNANVLLQIDNARLAADDF
RTKYETELNLRMSVEADINGLRRVLDELTLARADLEMQIESLKEELAYLK
KNHEEEMNALRGQVGGDVNVEMDAAPGVDLSRILNEMRDQYEKMAEKNRK
DAEEWFFTKTEELNREVATNSELVQSGKSEISELRRTMQNLEIELQSQLS
MKASLENSLEETKGRYCMQLAQIQEMIGSVEEQLAQLRCEMEQQNQEYKI
LLDVKTRLEQEIATYRRLLEGEDAHLSSSQFSSGSQSSRDVTSSSRQIRT
KVMDVHDGKVVSTHEQVLRTKN

Локалізований у цитоплазмі, ядрі.

Література[ред. | ред. код]

  • Marchuk D., McCrohon S., Fuchs E. (1984). Remarkable conservation of structure among intermediate filament genes.. Cell 39: 491 — 498.  PubMed DOI:10.1016/0092-8674(84)90456-2
  • Marchuk D., McCrohon S., Fuchs E. (1985). Complete sequence of a gene encoding a human type I keratin: sequences homologous to enhancer elements in the regulatory region of the gene.. Proc. Natl. Acad. Sci. U.S.A. 82: 1609 — 1613.  PubMed DOI:10.1073/pnas.82.6.1609
  • The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).. Genome Res. 14: 2121 — 2127. 2004.  PubMed DOI:10.1101/gr.2596504
  • Hanukoglu I., Fuchs E. (1982). The cDNA sequence of a human epidermal keratin: divergence of sequence but conservation of structure among intermediate filament proteins.. Cell 31: 243 — 252.  PubMed DOI:10.1016/0092-8674(82)90424-X
  • Chan Y.-M., Cheng J., Gedde-Dahl T. Jr., Niemi K.M., Fuchs E. (1996). Genetic analysis of a severe case of Dowling-Meara epidermolysis bullosa simplex.. J. Invest. Dermatol. 106: 327 — 334.  PubMed DOI:10.1111/1523-1747.ep12342985
  • Yamanishi K., Matsuki M., Konishi K., Yasuno H. (1994). A novel mutation of Leu122 to Phe at a highly conserved hydrophobic residue in the helix initiation motif of keratin 14 in epidermolysis bullosa simplex.. Hum. Mol. Genet. 3: 1171 — 1172.  PubMed DOI:10.1093/hmg/3.7.1171

Примітки[ред. | ред. код]

Див. також[ред. | ред. код]