Кератин-16

Матеріал з Вікіпедії — вільної енциклопедії.
Перейти до навігації Перейти до пошуку
Кератин-16
Ідентифікатори
Символи KRT16, CK16, FNEPPK, K16, K1CP, KRT16A, NEPPK, PC1, keratin 16
Зовнішні ІД OMIM: 148067 MGI: 96690 HomoloGene: 21145 GeneCards: KRT16
Ортологи
Види Людина Миша
Entrez
Ensembl
UniProt
RefSeq (мРНК)
NM_005557
NM_008470
NM_001313958
RefSeq (білок)
NP_005548
NP_001300887
NP_032496
Локус (UCSC) Хр. 17: 41.61 – 41.62 Mb Хр. 11: 100.25 – 100.25 Mb
PubMed search [1] [2]
Вікідані
Див./Ред. для людейДив./Ред. для мишей

Кератин-16 (англ. Keratin 16) – білок, який кодується геном KRT16, розташованим у людей на короткому плечі 17-ї хромосоми. [3] Довжина поліпептидного ланцюга білка становить 473 амінокислот, а молекулярна маса — 51 268[4].

Належить до великої родини кератинів — структурних білків цитоскелету.

Мутації в цьому гені призводять до рідкісного захворювання пахіоніхія спадкова[en].

Послідовність амінокислот
1020304050
MTTCSRQFTSSSSMKGSCGIGGGIGGGSSRISSVLAGGSCRAPSTYGGGL
SVSSRFSSGGACGLGGGYGGGFSSSSSFGSGFGGGYGGGLGAGFGGGLGA
GFGGGFAGGDGLLVGSEKVTMQNLNDRLASYLDKVRALEEANADLEVKIR
DWYQRQRPSEIKDYSPYFKTIEDLRNKIIAATIENAQPILQIDNARLAAD
DFRTKYEHELALRQTVEADVNGLRRVLDELTLARTDLEMQIEGLKEELAY
LRKNHEEEMLALRGQTGGDVNVEMDAAPGVDLSRILNEMRDQYEQMAEKN
RRDAETWFLSKTEELNKEVASNSELVQSSRSEVTELRRVLQGLEIELQSQ
LSMKASLENSLEETKGRYCMQLSQIQGLIGSVEEQLAQLRCEMEQQSQEY
QILLDVKTRLEQEIATYRRLLEGEDAHLSSQQASGQSYSSREVFTSSSSS
SSRQTRPILKEQSSSSFSQGQSS

Література[ред. | ред. код]

  • Raychaudhury A., Marchuk D., Lindhurst M., Fuchs E. (1986). Three tightly linked genes encoding human type I keratins: conservation of sequence in the 5'-untranslated leader and 5'-upstream regions of coexpressed keratin genes.. Mol. Cell. Biol. 6: 539 — 548.  PubMed DOI:10.1128/MCB.6.2.539
  • Rosenberg M., Raychaudhury A., Shows T.B., le Beau M.M., Fuchs E. (1988). A group of type I keratin genes on human chromosome 17: characterization and expression.. Mol. Cell. Biol. 8: 722 — 736.  PubMed DOI:10.1128/MCB.8.2.722
  • Paladini R.D., Takahashi K., Gant T.M., Coulombe P.A. (1995). cDNA cloning and bacterial expression of the human type I keratin 16.. Biochem. Biophys. Res. Commun. 215: 517 — 523.  PubMed DOI:10.1006/bbrc.1995.2495
  • The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).. Genome Res. 14: 2121 — 2127. 2004.  PubMed DOI:10.1101/gr.2596504
  • Connors J.B., Rahil A.K., Smith F.J.D., McLean W.H.I., Milstone L.M. (2001). Delayed-onset pachyonychia congenita associated with a novel mutation in the central 2B domain of keratin 16.. Br. J. Dermatol. 144: 1058 — 1062.  PubMed DOI:10.1046/j.1365-2133.2001.04199.x
  • Paris F., Hurtado C., Azon A., Aguado L., Vizmanos J.L. (2013). A new KRT16 mutation associated with a phenotype of pachyonychia congenita.. Exp. Dermatol. 22: 838 — 839.  PubMed DOI:10.1111/exd.12262

Примітки[ред. | ред. код]

  1. Human PubMed Reference:. 
  2. Mouse PubMed Reference:. 
  3. HUGO Gene Nomenclature Commitee, HGNC:6423 (англ.). Процитовано 30 січня 2017. 
  4. UniProt, P08779 (англ.). Процитовано 30 січня 2017. 

Див. також[ред. | ред. код]