Кератин-18

Матеріал з Вікіпедії — вільної енциклопедії.
Перейти до навігації Перейти до пошуку
Кератин-18
Ідентифікатори
Символи KRT18, CK-18, CYK18, K18, keratin 18
Зовнішні ІД OMIM: 148070 MGI: 96692 HomoloGene: 55448 GeneCards: KRT18
Шаблон експресії
PBB GE KRT18 201596 x at fs.png
Більше даних
Ортологи
Види Людина Миша
Entrez
Ensembl
UniProt
RefSeq (мРНК)
NM_199187
NM_000224
NM_010664
RefSeq (білок)
NP_000215
NP_954657
NP_034794
Локус (UCSC) Хр. 12: 52.95 – 52.95 Mb Хр. 15: 102.03 – 102.03 Mb
PubMed search [1] [2]
Вікідані
Див./Ред. для людейДив./Ред. для мишей

Кератин-18 (англ. Keratin 18) – білок, який кодується геном KRT18, розташованим у людей на короткому плечі 12-ї хромосоми. [3] Довжина поліпептидного ланцюга білка становить 430 амінокислот, а молекулярна маса — 48 058[4].

Послідовність амінокислот
1020304050
MSFTTRSTFSTNYRSLGSVQAPSYGARPVSSAASVYAGAGGSGSRISVSR
STSFRGGMGSGGLATGIAGGLAGMGGIQNEKETMQSLNDRLASYLDRVRS
LETENRRLESKIREHLEKKGPQVRDWSHYFKIIEDLRAQIFANTVDNARI
VLQIDNARLAADDFRVKYETELAMRQSVENDIHGLRKVIDDTNITRLQLE
TEIEALKEELLFMKKNHEEEVKGLQAQIASSGLTVEVDAPKSQDLAKIMA
DIRAQYDELARKNREELDKYWSQQIEESTTVVTTQSAEVGAAETTLTELR
RTVQSLEIDLDSMRNLKASLENSLREVEARYALQMEQLNGILLHLESELA
QTRAEGQRQAQEYEALLNIKVKLEAEIATYRRLLEDGEDFNLGDALDSSN
SMQTIQKTTTRRIVDGKVVSETNDTKVLRH

Задіяний у таких біологічних процесах як взаємодія хазяїн-вірус, клітинний цикл. Локалізований у цитоплазмі, ядрі.

Література[ред. | ред. код]

  • Oshima R.G., Millan J.L., Cecena G. (1986). Comparison of mouse and human keratin 18: a component of intermediate filaments expressed prior to implantation.. Differentiation 33: 61 — 68.  PubMed DOI:10.1111/j.1432-0436.1986.tb00411.x
  • The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).. Genome Res. 14: 2121 — 2127. 2004.  PubMed DOI:10.1101/gr.2596504
  • Kulesh D.A., Oshima R.G. (1988). Cloning of the human keratin 18 gene and its expression in nonepithelial mouse cells.. Mol. Cell. Biol. 8: 1540 — 1550.  PubMed DOI:10.1128/MCB.8.4.1540
  • Ku N.O., Omary M.B. (1994). Identification of the major physiologic phosphorylation site of human keratin 18: potential kinases and a role in filament reorganization.. J. Cell Biol. 127: 161 — 171.  PubMed DOI:10.1083/jcb.127.1.161
  • Ku N.-O., Omary M.B. (1995). Identification and mutational analysis of the glycosylation sites of human keratin 18.. J. Biol. Chem. 270: 11820 — 11827.  PubMed DOI:10.1074/jbc.270.20.11820
  • Ku N.O., Michie S., Oshima R.G., Omary M.B. (1995). Chronic hepatitis, hepatocyte fragility, and increased soluble phosphoglycokeratins in transgenic mice expressing a keratin 18 conserved arginine mutant.. J. Cell Biol. 131: 1303 — 1314.  PubMed DOI:10.1083/jcb.131.5.1303

Примітки[ред. | ред. код]

  1. Human PubMed Reference:. 
  2. Mouse PubMed Reference:. 
  3. HUGO Gene Nomenclature Commitee, HGNC:6430 (англ.). Процитовано 6 лютого 2017. 
  4. UniProt, P05783 (англ.). Процитовано 6 лютого 2017. 

Див. також[ред. | ред. код]