Кератин-19

Матеріал з Вікіпедії — вільної енциклопедії.
Перейти до навігації Перейти до пошуку
Кератин-19
Ідентифікатори
Символи KRT19, CK19, K19, K1CS, keratin 19
Зовнішні ІД OMIM: 148020 MGI: 96693 HomoloGene: 1713 GeneCards: KRT19
Шаблон експресії
PBB GE KRT19 201650 at fs.png
Більше даних
Ортологи
Види Людина Миша
Entrez
Ensembl
UniProt
RefSeq (мРНК)
NM_002276
NM_008471
NM_001313963
RefSeq (білок)
NP_002267
NP_001300892
NP_032497
Локус (UCSC) Хр. 17: 41.52 – 41.53 Mb Хр. 11: 100.14 – 100.15 Mb
PubMed search [1] [2]
Вікідані
Див./Ред. для людейДив./Ред. для мишей

Кератин-19 (англ. Keratin 19) – білок, який кодується геном KRT19, розташованим у людей на короткому плечі 17-ї хромосоми. [3] Довжина поліпептидного ланцюга білка становить 400 амінокислот, а молекулярна маса — 44 106[4].

Послідовність амінокислот
1020304050
MTSYSYRQSSATSSFGGLGGGSVRFGPGVAFRAPSIHGGSGGRGVSVSSA
RFVSSSSSGAYGGGYGGVLTASDGLLAGNEKLTMQNLNDRLASYLDKVRA
LEAANGELEVKIRDWYQKQGPGPSRDYSHYYTTIQDLRDKILGATIENSR
IVLQIDNARLAADDFRTKFETEQALRMSVEADINGLRRVLDELTLARTDL
EMQIEGLKEELAYLKKNHEEEISTLRGQVGGQVSVEVDSAPGTDLAKILS
DMRSQYEVMAEQNRKDAEAWFTSRTEELNREVAGHTEQLQMSRSEVTDLR
RTLQGLEIELQSQLSMKAALEDTLAETEARFGAQLAHIQALISGIEAQLG
DVRADSERQNQEYQRLMDIKSRLEQEIATYRSLLEGQEDHYNNLSASKVL

Задіяний у такому біологічному процесі як взаємодія хазяїн-вірус.

Література[ред. | ред. код]

  • Stasiak P.C., Lane E.B. (1987). Sequence of cDNA coding for human keratin 19.. Nucleic Acids Res. 15: 10058 — 10058.  PubMed DOI:10.1093/nar/15.23.10058
  • Eckert R.L. (1988). Sequence of the human 40-kDa keratin reveals an unusual structure with very high sequence identity to the corresponding bovine keratin.. Proc. Natl. Acad. Sci. U.S.A. 85: 1114 — 1118.  PubMed DOI:10.1073/pnas.85.4.1114
  • Stasiak P.C., Purkis P.E., Leigh I.M., Lane E.B. (1989). Keratin 19: predicted amino acid sequence and broad tissue distribution suggest it evolved from keratinocyte keratins.. J. Invest. Dermatol. 92: 707 — 716.  PubMed DOI:10.1111/1523-1747.ep12721500
  • Whittock N.V., Eady R.A.J., McGrath J.A. (2000). Genomic organization and amplification of the human keratin 15 and 19 genes.. Biochem. Biophys. Res. Commun. 267: 462 — 465.  PubMed DOI:10.1006/bbrc.1999.1966
  • The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).. Genome Res. 14: 2121 — 2127. 2004.  PubMed DOI:10.1101/gr.2596504
  • Kagaya M., Kaneko S., Ohno H., Inamura K., Kobayashi K. (2001). Cloning and characterization of the 5'-flanking region of human cytokeratin 19 gene in human cholangiocarcinoma cell line.. J. Hepatol. 35: 504 — 511.  PubMed DOI:10.1016/S0168-8278(01)00167-2

Примітки[ред. | ред. код]

  1. Human PubMed Reference:. 
  2. Mouse PubMed Reference:. 
  3. HUGO Gene Nomenclature Commitee, HGNC:6436 (англ.). Процитовано 30 січня 2017. 
  4. UniProt, P08727 (англ.). Процитовано 30 січня 2017. 

Див. також[ред. | ред. код]