Кератин-2

Матеріал з Вікіпедії — вільної енциклопедії.
Перейти до навігації Перейти до пошуку
Кератин-2
Ідентифікатори
Символи KRT2, CK-2e, K2e, KRT2A, KRT2E, KRTE, keratin 2
Зовнішні ІД OMIM: 600194 MGI: 96699 HomoloGene: 30974 GeneCards: KRT2
Пов'язані генетичні захворювання
ichthyosis bullosa of Siemens[1]
Ортологи
Види Людина Миша
Entrez
Ensembl
UniProt
RefSeq (мРНК)
NM_000423
NM_010668
RefSeq (білок)
NP_000414
NP_034798
Локус (UCSC) Хр. 12: 52.64 – 52.65 Mb Хр. 15: 101.81 – 101.82 Mb
PubMed search [2] [3]
Вікідані
Див./Ред. для людейДив./Ред. для мишей

Кератин-2 (англ. Keratin 2) – білок, який кодується геном KRT2, розташованим у людей на короткому плечі 12-ї хромосоми. [4] Довжина поліпептидного ланцюга білка становить 639 амінокислот, а молекулярна маса — 65 433[5]. Належить до великої родини кератинів — структурних білків цитоскелету.

Послідовність амінокислот
1020304050
MSCQISCKSRGRGGGGGGFRGFSSGSAVVSGGSRRSTSSFSCLSRHGGGG
GGFGGGGFGSRSLVGLGGTKSISISVAGGGGGFGAAGGFGGRGGGFGGGS
SFGGGSGFSGGGFGGGGFGGGRFGGFGGPGGVGGLGGPGGFGPGGYPGGI
HEVSVNQSLLQPLNVKVDPEIQNVKAQEREQIKTLNNKFASFIDKVRFLE
QQNQVLQTKWELLQQMNVGTRPINLEPIFQGYIDSLKRYLDGLTAERTSQ
NSELNNMQDLVEDYKKKYEDEINKRTAAENDFVTLKKDVDNAYMIKVELQ
SKVDLLNQEIEFLKVLYDAEISQIHQSVTDTNVILSMDNSRNLDLDSIIA
EVKAQYEEIAQRSKEEAEALYHSKYEELQVTVGRHGDSLKEIKIEISELN
RVIQRLQGEIAHVKKQCKNVQDAIADAEQRGEHALKDARNKLNDLEEALQ
QAKEDLARLLRDYQELMNVKLALDVEIATYRKLLEGEECRMSGDLSSNVT
VSVTSSTISSNVASKAAFGGSGGRGSSSGGGYSSGSSSYGSGGRQSGSRG
GSGGGGSISGGGYGSGGGSGGRYGSGGGSKGGSISGGGYGSGGGKHSSGG
GSRGGSSSGGGYGSGGGGSSSVKGSSGEAFGSSVTFSFR

Література[ред. | ред. код]

  • Collin C., Moll R., Kubicka S., Ouhayoun J.-P., Franke W.W. (1992). Characterization of human cytokeratin 2, an epidermal cytoskeletal protein synthesized late during differentiation.. Exp. Cell Res. 202: 132 — 141.  PubMed DOI:10.1016/0014-4827(92)90412-2
  • The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).. Genome Res. 14: 2121 — 2127. 2004.  PubMed DOI:10.1101/gr.2596504
  • Smith L.T., Underwood R.A., McLean W.H.I. (1999). Ontogeny and regional variability of keratin 2e (K2e) in developing human fetal skin: a unique spatial and temporal pattern of keratin expression in development.. Br. J. Dermatol. 140: 582 — 591.  PubMed DOI:10.1046/j.1365-2133.1999.02755.x
  • Moraru R., Cserhalmi-Friedman P.B., Grossman M.E., Schneiderman P., Christiano A.M. (1999). Ichthyosis bullosa of Siemens resulting from a novel missense mutation near the helix termination motif of the keratin 2e gene.. Clin. Exp. Dermatol. 24: 412 — 415.  PubMed DOI:10.1046/j.1365-2230.1999.00514.x
  • Irvine A.D., Smith F.J., Shum K.W., Williams H.C., McLean W.H.I. (2000). A novel mutation in the 2B domain of keratin 2e causing ichthyosis bullosa of Siemens.. Clin. Exp. Dermatol. 25: 648 — 651.  PubMed DOI:10.1046/j.1365-2230.2000.00728.x
  • Takizawa Y., Akiyama M., Nagashima M., Shimizu H. (2000). A novel asparagine-->aspartic acid mutation in the rod 1A domain in keratin 2e in a Japanese family with ichthyosis bullosa of Siemens.. J. Invest. Dermatol. 114: 193 — 195.  PubMed DOI:10.1046/j.1523-1747.2000.00817.x

Примітки[ред. | ред. код]

Див. також[ред. | ред. код]