Кератин-6B

Матеріал з Вікіпедії — вільної енциклопедії.
Перейти до навігації Перейти до пошуку
Кератин-6B
Ідентифікатори
Символи KRT6B, CK-6B, CK6B, K6B, KRTL1, PC2, PC4, keratin 6B
Зовнішні ІД OMIM: 148042 MGI: 1333768 HomoloGene: 136794 GeneCards: KRT6B
Ортологи
Види Людина Миша
Entrez
Ensembl
UniProt
RefSeq (мРНК)
NM_005555
NM_010669
RefSeq (білок)
NP_005546
NP_034799
Локус (UCSC) Хр. 12: 52.45 – 52.45 Mb Хр. 15: 101.68 – 101.68 Mb
PubMed search [1] [2]
Вікідані
Див./Ред. для людейДив./Ред. для мишей

Кератин-6B (англ. Keratin 6B) – білок, який кодується геном KRT6B, розташованим у людей на короткому плечі 12-ї хромосоми. [3] Довжина поліпептидного ланцюга білка становить 564 амінокислот, а молекулярна маса — 60 067[4].

Послідовність амінокислот
1020304050
MASTSTTIRSHSSSRRGFSANSARLPGVSRSGFSSISVSRSRGSGGLGGA
CGGAGFGSRSLYGLGGSKRISIGGGSCAISGGYGSRAGGSYGFGGAGSGF
GFGGGAGIGFGLGGGAGLAGGFGGPGFPVCPPGGIQEVTVNQSLLTPLNL
QIDPAIQRVRAEEREQIKTLNNKFASFIDKVRFLEQQNKVLDTKWTLLQE
QGTKTVRQNLEPLFEQYINNLRRQLDNIVGERGRLDSELRNMQDLVEDLK
NKYEDEINKRTAAENEFVTLKKDVDAAYMNKVELQAKADTLTDEINFLRA
LYDAELSQMQTHISDTSVVLSMDNNRNLDLDSIIAEVKAQYEEIAQRSRA
EAESWYQTKYEELQITAGRHGDDLRNTKQEIAEINRMIQRLRSEIDHVKK
QCANLQAAIADAEQRGEMALKDAKNKLEGLEDALQKAKQDLARLLKEYQE
LMNVKLALDVEIATYRKLLEGEECRLNGEGVGQVNISVVQSTVSSGYGGA
SGVGSGLGLGGGSSYSYGSGLGVGGGFSSSSGRATGGGLSSVGGGSSTIK
YTTTSSSSRKSYKH

Література[ред. | ред. код]

  • Takahashi K., Paladini R.D., Coulombe P.A. (1995). Cloning and characterization of multiple human genes and cDNAs encoding highly related type II keratin 6 isoforms.. J. Biol. Chem. 270: 18581 — 18592.  PubMed DOI:10.1074/jbc.270.31.18581
  • Tyner A.L., Eichman M.J., Fuchs E. (1985). The sequence of a type II keratin gene expressed in human skin: conservation of structure among all intermediate filament genes.. Proc. Natl. Acad. Sci. U.S.A. 82: 4683 — 4687.  PubMed DOI:10.1073/pnas.82.14.4683
  • The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).. Genome Res. 14: 2121 — 2127. 2004.  PubMed DOI:10.1101/gr.2596504

Примітки[ред. | ред. код]

  1. Human PubMed Reference:. 
  2. Mouse PubMed Reference:. 
  3. HUGO Gene Nomenclature Commitee, HGNC:6444 (англ.). Процитовано 30 січня 2017. 
  4. UniProt, P04259 (англ.). Процитовано 30 січня 2017. 

Див. також[ред. | ред. код]