Кератин-8

Матеріал з Вікіпедії — вільної енциклопедії.
Перейти до навігації Перейти до пошуку
Кератин-8
Ідентифікатори
Символи KRT8, CARD2, CK-8, CK8, CYK8, K2C8, K8, KO, keratin 8
Зовнішні ІД OMIM: 148060 MGI: 96705 HomoloGene: 55643 GeneCards: KRT8
Ортологи
Види Людина Миша
Entrez
Ensembl
UniProt
RefSeq (мРНК)
NM_001256282
NM_001256293
NM_002273
NM_031170
RefSeq (білок)
NP_001243211
NP_001243222
NP_002264
NP_112447
Локус (UCSC) Хр. 12: 52.9 – 52.95 Mb Хр. 15: 102 – 102 Mb
PubMed search [1] [2]
Вікідані
Див./Ред. для людейДив./Ред. для мишей

Кератин-8 (англ. Keratin 8) – білок, який кодується геном KRT8, розташованим у людей на короткому плечі 12-ї хромосоми. [3] Довжина поліпептидного ланцюга білка становить 483 амінокислот, а молекулярна маса — 53 704[4].

Послідовність амінокислот
1020304050
MSIRVTQKSYKVSTSGPRAFSSRSYTSGPGSRISSSSFSRVGSSNFRGGL
GGGYGGASGMGGITAVTVNQSLLSPLVLEVDPNIQAVRTQEKEQIKTLNN
KFASFIDKVRFLEQQNKMLETKWSLLQQQKTARSNMDNMFESYINNLRRQ
LETLGQEKLKLEAELGNMQGLVEDFKNKYEDEINKRTEMENEFVLIKKDV
DEAYMNKVELESRLEGLTDEINFLRQLYEEEIRELQSQISDTSVVLSMDN
SRSLDMDSIIAEVKAQYEDIANRSRAEAESMYQIKYEELQSLAGKHGDDL
RRTKTEISEMNRNISRLQAEIEGLKGQRASLEAAIADAEQRGELAIKDAN
AKLSELEAALQRAKQDMARQLREYQELMNVKLALDIEIATYRKLLEGEES
RLESGMQNMSIHTKTTSGYAGGLSSAYGGLTSPGLSYSLGSSFGSGAGSS
SFSRTSSSRAVVVKKIETRDGKLVSESSDVLPK

Задіяний у такому біологічному процесі як взаємодія хазяїн-вірус. Локалізований у цитоплазмі, ядрі.

Література[ред. | ред. код]

  • Krauss S., Franke W.W. (1990). Organization and sequence of the human gene encoding cytokeratin 8.. Gene 86: 241 — 249.  PubMed DOI:10.1016/0378-1119(90)90285-Y
  • Yamamoto R., Kao L.C., McKnight C.E., Strauss J.F. III (1990). Cloning and sequence of cDNA for human placental cytokeratin 8. Regulation of the mRNA in trophoblastic cells by cAMP.. Mol. Endocrinol. 4: 370 — 374.  PubMed DOI:10.1210/mend-4-3-370
  • Ku N.-O., Omary M.B. (1997). Phosphorylation of human keratin 8 in vivo at conserved head domain serine 23 and at epidermal growth factor-stimulated tail domain serine 431.. J. Biol. Chem. 272: 7556 — 7564.  PubMed DOI:10.1074/jbc.272.11.7556
  • The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).. Genome Res. 14: 2121 — 2127. 2004.  PubMed DOI:10.1101/gr.2596504
  • Kulesh D.A., Cecena G., Darmon Y.M., Vasseur M., Oshima R.G. (1989). Posttranslational regulation of keratins: degradation of mouse and human keratins 18 and 8.. Mol. Cell. Biol. 9: 1553 — 1565.  PubMed DOI:10.1128/MCB.9.4.1553
  • Barrett A.W., Cort E.M., Patel P., Berkovitz B.K.B. (2000). An immunohistological study of cytokeratin 20 in human and mammalian oral epithelium.. Arch. Oral Biol. 45: 879 — 887.  PubMed DOI:10.1016/S0003-9969(00)00050-9

Примітки[ред. | ред. код]

  1. Human PubMed Reference:. 
  2. Mouse PubMed Reference:. 
  3. HUGO Gene Nomenclature Commitee, HGNC:6446 (англ.). Процитовано 6 лютого 2017. 
  4. UniProt, P05787 (англ.). Процитовано 6 лютого 2017. 

Див. також[ред. | ред. код]