Кератин-9

Матеріал з Вікіпедії — вільної енциклопедії.
Перейти до навігації Перейти до пошуку
Кератин-9
Ідентифікатори
Символи KRT9, CK-9, EPPK, K9, keratin 9
Зовнішні ІД OMIM: 607606 HomoloGene: 133554 GeneCards: KRT9
Ортологи
Види Людина Миша
Entrez
Ensembl
UniProt
RefSeq (мРНК)
NM_000226
н/д
RefSeq (білок)
NP_000217
н/д
Локус (UCSC) Хр. 17: 41.57 – 41.57 Mb н/д
PubMed search [1] н/д
Вікідані
Див./Ред. для людей

Кератин-9 (англ. Keratin 9) – білок, який кодується геном KRT9, розташованим у людей на короткому плечі 17-ї хромосоми. [2] Довжина поліпептидного ланцюга білка становить 623 амінокислот, а молекулярна маса — 62 064[3]. Належить до великої родини кератинів — структурних білків цитоскелету.

Послідовність амінокислот
1020304050
MSCRQFSSSYLSRSGGGGGGGLGSGGSIRSSYSRFSSSGGGGGGGRFSSS
SGYGGGSSRVCGRGGGGSFGYSYGGGSGGGFSASSLGGGFGGGSRGFGGA
SGGGYSSSGGFGGGFGGGSGGGFGGGYGSGFGGFGGFGGGAGGGDGGILT
ANEKSTMQELNSRLASYLDKVQALEEANNDLENKIQDWYDKKGPAAIQKN
YSPYYNTIDDLKDQIVDLTVGNNKTLLDIDNTRMTLDDFRIKFEMEQNLR
QGVDADINGLRQVLDNLTMEKSDLEMQYETLQEELMALKKNHKEEMSQLT
GQNSGDVNVEINVAPGKDLTKTLNDMRQEYEQLIAKNRKDIENQYETQIT
QIEHEVSSSGQEVQSSAKEVTQLRHGVQELEIELQSQLSKKAALEKSLED
TKNRYCGQLQMIQEQISNLEAQITDVRQEIECQNQEYSLLLSIKMRLEKE
IETYHNLLEGGQEDFESSGAGKIGLGGRGGSGGSYGRGSRGGSGGSYGGG
GSGGGYGGGSGSRGGSGGSYGGGSGSGGGSGGGYGGGSGGGHSGGSGGGH
SGGSGGNYGGGSGSGGGSGGGYGGGSGSRGGSGGSHGGGSGFGGESGGSY
GGGEEASGSGGGYGGGSGKSSHS

Література[ред. | ред. код]

  • Langbein L., Heid H.W., Moll I., Franke W.W. (1993). Molecular characterization of the body site-specific human epidermal cytokeratin 9: cDNA cloning, amino acid sequence, and tissue specificity of gene expression.. Differentiation 55: 57 — 72.  PubMed DOI:10.1111/j.1432-0436.1993.tb00033.x
  • Kobayashi S., Tanaka T., Matsuyoshi N., Imamura S. (1996). Keratin 9 point mutation in the pedigree of epidermolytic hereditary palmoplantar keratoderma perturbs keratin intermediate filament network formation.. FEBS Lett. 386: 149 — 155.  PubMed DOI:10.1016/0014-5793(96)00393-6
  • The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).. Genome Res. 14: 2121 — 2127. 2004.  PubMed DOI:10.1101/gr.2596504
  • Rosen E.M., Meromsky L., Romero R., Setter E., Goldberg I. (1990). Human placenta contains an epithelial scatter protein.. Biochem. Biophys. Res. Commun. 168: 1082 — 1088.  PubMed DOI:10.1016/0006-291X(90)91140-N
  • Kobayashi S., Kore-eda S., Tanaka T. (1999). Demonstration of the pathogenic effect of point mutated keratin 9 in vivo.. FEBS Lett. 447: 39 — 43.  PubMed DOI:10.1016/S0014-5793(99)00233-1
  • Hennies H.-C., Zehender D., Kunze J., Kuester W., Reis A. (1994). Keratin 9 gene mutational heterogeneity in patients with epidermolytic palmoplantar keratoderma.. Hum. Genet. 93: 649 — 654.  PubMed DOI:10.1007/BF00201564

Примітки[ред. | ред. код]

  1. Human PubMed Reference:. 
  2. HUGO Gene Nomenclature Commitee, HGNC:6447 (англ.). Процитовано 30 січня 2017. 
  3. UniProt, P35527 (англ.). Процитовано 30 січня 2017. 

Див. також[ред. | ред. код]