Кортикотропний рилізінг-фактор

Матеріал з Вікіпедії — вільної енциклопедії.
Перейти до навігації Перейти до пошуку
Кортикотропний рилізінг-фактор
Ідентифікатори
Символи Corticotropin-releasing hormonecorticotropin-releasing factorCRHCRFcorticoliberin
Зовнішні ІД GeneCards: [1]
Шаблон експресії
PBB GE CRH 205630 at fs.png
Більше даних
Ортологи
Види Людина Миша
Entrez
Ensembl
UniProt
RefSeq (мРНК)
н/д
н/д
RefSeq (білок)
н/д
н/д
Локус (UCSC) н/д н/д
PubMed search н/д н/д
Вікідані
Див./Ред. для людей

CRH (англ. Corticotropin releasing hormone) – білок, який кодується однойменним геном, розташованим у людей на короткому плечі 8-ї хромосоми.[1] Довжина поліпептидного ланцюга білка становить 196 амінокислот, а молекулярна маса — 21 422[2].

Послідовність амінокислот
1020304050
MRLPLLVSAGVLLVALLPCPPCRALLSRGPVPGARQAPQHPQPLDFFQPP
PQSEQPQQPQARPVLLRMGEEYFLRLGNLNKSPAAPLSPASSLLAGGSGS
RPSPEQATANFFRVLLQQLLLPRRSLDSPAALAERGARNALGGHQEAPER
ERRSEEPPISLDLTFHLLREVLEMARAEQLAQQAHSNRKLMEIIGK

Кодований геном білок за функцією належить до гормонів. Секретований назовні.

Література[ред. | ред. код]

  • Robinson B.G., D'Angio L.A. Jr., Pasieka K.B., Majzoub J.A. (1989). Preprocorticotropin releasing hormone: cDNA sequence and in vitro processing.. Mol. Cell. Endocrinol. 61: 175 — 180.  PubMed DOI:10.1016/0303-7207(89)90128-7
  • The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).. Genome Res. 14: 2121 — 2127. 2004.  PubMed DOI:10.1101/gr.2596504
  • Romier C., Bernassau J.-M., Cambillau C., Darbon H. (1993). Solution structure of human corticotropin releasing factor by 1H NMR and distance geometry with restrained molecular dynamics.. Protein Eng. 6: 149 — 156.  PubMed DOI:10.1093/protein/6.2.149
  • Pioszak A.A., Parker N.R., Suino-Powell K., Xu H.E. (2008). Molecular recognition of corticotropin-releasing factor by its G-protein-coupled receptor CRFR1.. J. Biol. Chem. 283: 32900 — 32912.  PubMed DOI:10.1074/jbc.M805749200

Примітки[ред. | ред. код]

  1. HUGO Gene Nomenclature Commitee, HGNC:2355 (англ.). Процитовано 7 вересня 2017. 
  2. UniProt, P06850 (англ.). Процитовано 7 вересня 2017. 

Див. також[ред. | ред. код]