Ламін A/C

Матеріал з Вікіпедії — вільної енциклопедії.
Перейти до навігації Перейти до пошуку
Ламін A/C
Protein LMNA PDB 1ifr.png
Наявні структури
PDBПошук ортологів: PDBe RCSB
Ідентифікатори
Символи LMNA, CDCD1, CDDC, CMD1A, CMT2B1, EMD2, FPL, FPLD, FPLD2, HGPS, IDC, LDP1, LFP, LGMD1B, LMN1, LMNC, LMNL1, PRO1, lamin A/C, MADA
Зовнішні ІД OMIM: 150330 MGI: 96794 HomoloGene: 41321 GeneCards: LMNA
Пов'язані генетичні захворювання
Charcot-Marie-Tooth disease type 2B1, прогерія, Restrictive dermopathy, heart-hand syndrome, Slovenian type, congenital muscular dystrophy due to LMNA mutation[1]
Шаблон експресії
PBB GE LMNA 214213 x at fs.png

PBB GE LMNA 203411 s at fs.png

PBB GE LMNA 212086 x at fs.png
Більше даних
Ортологи
Види Людина Миша
Entrez
Ensembl
UniProt
RefSeq (мРНК)
NM_001002011
NM_001111102
NM_019390
RefSeq (білок)
NP_001002011
NP_001104572
NP_062263
Локус (UCSC) Хр. 1: 156.08 – 156.14 Mb Хр. 3: 88.48 – 88.51 Mb
PubMed search [2] [3]
Вікідані
Див./Ред. для людейДив./Ред. для мишей

Ламін A/C (англ. Lamin A/C) – білок, який кодується геном LMNA, розташованим у людей на короткому плечі 1-ї хромосоми. [4] Довжина поліпептидного ланцюга білка становить 664 амінокислот, а молекулярна маса — 74 139[5].

Послідовність амінокислот
1020304050
METPSQRRATRSGAQASSTPLSPTRITRLQEKEDLQELNDRLAVYIDRVR
SLETENAGLRLRITESEEVVSREVSGIKAAYEAELGDARKTLDSVAKERA
RLQLELSKVREEFKELKARNTKKEGDLIAAQARLKDLEALLNSKEAALST
ALSEKRTLEGELHDLRGQVAKLEAALGEAKKQLQDEMLRRVDAENRLQTM
KEELDFQKNIYSEELRETKRRHETRLVEIDNGKQREFESRLADALQELRA
QHEDQVEQYKKELEKTYSAKLDNARQSAERNSNLVGAAHEELQQSRIRID
SLSAQLSQLQKQLAAKEAKLRDLEDSLARERDTSRRLLAEKEREMAEMRA
RMQQQLDEYQELLDIKLALDMEIHAYRKLLEGEEERLRLSPSPTSQRSRG
RASSHSSQTQGGGSVTKKRKLESTESRSSFSQHARTSGRVAVEEVDEEGK
FVRLRNKSNEDQSMGNWQIKRQNGDDPLLTYRFPPKFTLKAGQVVTIWAA
GAGATHSPPTDLVWKAQNTWGCGNSLRTALINSTGEEVAMRKLVRSVTVV
EDDEDEDGDDLLHHHHGSHCSSSGDPAEYNLRSRTVLCGTCGQPADKASA
SGSGAQVGGPISSGSSASSVTVTRSYRSVGGSGGGSFGDNLVTRSYLLGN
SSPRTQSPQNCSIM

Локалізований у ядрі.

Література[ред. | ред. код]

  • McKeon F.D., Kirschner M.W., Caput D. (1986). Homologies in both primary and secondary structure between nuclear envelope and intermediate filament proteins.. Nature 319: 463 — 468.  PubMed DOI:10.1038/319463a0
  • Fisher D.Z., Chaudhary N., Blobel G. (1986). cDNA sequencing of nuclear lamins A and C reveals primary and secondary structural homology to intermediate filament proteins.. Proc. Natl. Acad. Sci. U.S.A. 83: 6450 — 6454.  PubMed DOI:10.1073/pnas.83.17.6450
  • The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).. Genome Res. 14: 2121 — 2127. 2004.  PubMed DOI:10.1101/gr.2596504
  • Barton R.M., Worman H.J. (1999). Prenylated prelamin A interacts with Narf, a novel nuclear protein.. J. Biol. Chem. 274: 30008 — 30018.  PubMed DOI:10.1074/jbc.274.42.30008
  • Markiewicz E., Dechat T., Foisner R., Quinlan R.A., Hutchison C.J. (2002). Lamin A/C binding protein LAP2alpha is required for nuclear anchorage of retinoblastoma protein.. Mol. Biol. Cell 13: 4401 — 4413.  PubMed DOI:10.1091/mbc.E02-07-0450
  • Beausoleil S.A., Villen J., Gerber S.A., Rush J., Gygi S.P. (2006). A probability-based approach for high-throughput protein phosphorylation analysis and site localization.. Nat. Biotechnol. 24: 1285 — 1292.  PubMed DOI:10.1038/nbt1240

Примітки[ред. | ред. код]

Див. також[ред. | ред. код]