Ламін B1

Матеріал з Вікіпедії — вільної енциклопедії.
Перейти до навігації Перейти до пошуку
Ламін B1
Protein LMNB1 PDB 2KPW.png
Наявні структури
PDBПошук ортологів: PDBe RCSB
Ідентифікатори
Символи LMNB1, ADLD, LMN, LMN2, LMNB, lamin B1
Зовнішні ІД OMIM: 150340 MGI: 96795 HomoloGene: 55912 GeneCards: LMNB1
Пов'язані генетичні захворювання
adult-onset autosomal dominant demyelinating leukodystrophy[1]
Шаблон експресії
PBB GE LMNB1 203276 at fs.png
Більше даних
Ортологи
Види Людина Миша
Entrez
Ensembl
UniProt
RefSeq (мРНК)
NM_001198557
NM_005573
NM_010721
RefSeq (білок)
NP_001185486
NP_005564
NP_034851
Локус (UCSC) Хр. 5: 126.78 – 126.84 Mb Хр. 18: 56.71 – 56.75 Mb
PubMed search [2] [3]
Вікідані
Див./Ред. для людейДив./Ред. для мишей

Ламін B1 (англ. Lamin B1) – білок, який кодується геном LMNB1, розташованим у людей на короткому плечі 5-ї хромосоми. [4] Довжина поліпептидного ланцюга білка становить 586 амінокислот, а молекулярна маса — 66 408[5].

Послідовність амінокислот
1020304050
MATATPVPPRMGSRAGGPTTPLSPTRLSRLQEKEELRELNDRLAVYIDKV
RSLETENSALQLQVTEREEVRGRELTGLKALYETELADARRALDDTARER
AKLQIELGKCKAEHDQLLLNYAKKESDLNGAQIKLREYEAALNSKDAALA
TALGDKKSLEGDLEDLKDQIAQLEASLAAAKKQLADETLLKVDLENRCQS
LTEDLEFRKSMYEEEINETRRKHETRLVEVDSGRQIEYEYKLAQALHEMR
EQHDAQVRLYKEELEQTYHAKLENARLSSEMNTSTVNSAREELMESRMRI
ESLSSQLSNLQKESRACLERIQELEDLLAKEKDNSRRMLTDKEREMAEIR
DQMQQQLNDYEQLLDVKLALDMEISAYRKLLEGEEERLKLSPSPSSRVTV
SRASSSRSVRTTRGKRKRVDVEESEASSSVSISHSASATGNVCIEEIDVD
GKFIRLKNTSEQDQPMGGWEMIRKIGDTSVSYKYTSRYVLKAGQTVTIWA
ANAGVTASPPTDLIWKNQNSWGTGEDVKVILKNSQGEEVAQRSTVFKTTI
PEEEEEEEEAAGVVVEEELFHQQGTPRASNRSCAIM

Локалізований у ядрі, мембрані.

Література[ред. | ред. код]

  • Lin F., Worman H.J. (1995). Structural organization of the human gene (LMNB1) encoding nuclear lamin B1.. Genomics 27: 230 — 236.  PubMed DOI:10.1006/geno.1995.1036
  • The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).. Genome Res. 14: 2121 — 2127. 2004.  PubMed DOI:10.1101/gr.2596504
  • Beausoleil S.A., Villen J., Gerber S.A., Rush J., Gygi S.P. (2006). A probability-based approach for high-throughput protein phosphorylation analysis and site localization.. Nat. Biotechnol. 24: 1285 — 1292.  PubMed DOI:10.1038/nbt1240
  • Impens F., Radoshevich L., Cossart P., Ribet D. (2014). Mapping of SUMO sites and analysis of SUMOylation changes induced by external stimuli.. Proc. Natl. Acad. Sci. U.S.A. 111: 12432 — 12437.  PubMed DOI:10.1073/pnas.1413825111
  • Farnsworth C.C., Wolda S.L., Gelb M.H., Glomset J.A. (1989). Human lamin B contains a farnesylated cysteine residue.. J. Biol. Chem. 264: 20422 — 20429.  PubMed

Примітки[ред. | ред. код]

Див. також[ред. | ред. код]