Ліпопротеїнліпаза

Матеріал з Вікіпедії — вільної енциклопедії.
Перейти до навігації Перейти до пошуку
LPL
Ідентифікатори
Символи LPL, HDLCQ11, LIPD, lipoprotein lipase
Зовнішні ІД OMIM: 609708 MGI: 96820 HomoloGene: 200 GeneCards: LPL
Пов'язані генетичні захворювання
metabolic disease, lipid metabolism disorder, familial lipoprotein lipase deficiency[1]
Шаблон експресії
PBB GE LPL 203549 s at fs.png

PBB GE LPL 203548 s at fs.png
Більше даних
Ортологи
Види Людина Миша
Entrez
Ensembl
UniProt
RefSeq (мРНК)
NM_000237
NM_008509
RefSeq (білок)
NP_000228
NP_032535
Локус (UCSC) Хр. 8: 19.9 – 19.97 Mb Хр. 8: 68.88 – 68.91 Mb
PubMed search [2] [3]
Вікідані
Див./Ред. для людейДив./Ред. для мишей

LPL (англ. Lipoprotein lipase) – білок, який кодується однойменним геном, розташованим у людей на короткому плечі 8-ї хромосоми.[4] Довжина поліпептидного ланцюга білка становить 475 амінокислот, а молекулярна маса — 53 162[5].

Послідовність амінокислот
1020304050
MESKALLVLTLAVWLQSLTASRGGVAAADQRRDFIDIESKFALRTPEDTA
EDTCHLIPGVAESVATCHFNHSSKTFMVIHGWTVTGMYESWVPKLVAALY
KREPDSNVIVVDWLSRAQEHYPVSAGYTKLVGQDVARFINWMEEEFNYPL
DNVHLLGYSLGAHAAGIAGSLTNKKVNRITGLDPAGPNFEYAEAPSRLSP
DDADFVDVLHTFTRGSPGRSIGIQKPVGHVDIYPNGGTFQPGCNIGEAIR
VIAERGLGDVDQLVKCSHERSIHLFIDSLLNEENPSKAYRCSSKEAFEKG
LCLSCRKNRCNNLGYEINKVRAKRSSKMYLKTRSQMPYKVFHYQVKIHFS
GTESETHTNQAFEISLYGTVAESENIPFTLPEVSTNKTYSFLIYTEVDIG
ELLMLKLKWKSDSYFSWSDWWSSPGFAIQKIRVKAGETQKKVIFCSREKV
SHLQKGKAPAVFVKCHDKSLNKKSG

Кодований геном білок за функцією належить до гідролаз. Задіяний у таких біологічних процесах, як метаболізм ліпідів, деградація ліпідів. Білок має сайт для зв'язування з молекулою гепарину. Локалізований у клітинній мембрані, мембрані. Також секретований назовні.

Література[ред. | ред. код]

  • Wion K.L., Kirchgessner T.G., Lusis A.J., Schotz M.C., Lawn R.M. (1987). Human lipoprotein lipase complementary DNA sequence.. Science 235: 1638 — 1641.  PubMed DOI:10.1126/science.3823907
  • Gotoda T., Senda M., Gamou T., Furuichi Y., Oka K. (1989). Nucleotide sequence of human cDNA coding for a lipoprotein lipase (LPL) cloned from placental cDNA library.. Nucleic Acids Res. 17: 2351 — 2352.  PubMed DOI:10.1093/nar/17.6.2351
  • Takagi A., Ikeda Y., Yamamoto A. (1990). DNA sequence of lipoprotein lipase cDNA cloned from human monocytic leukemia THP-1 cells.. Nucleic Acids Res. 18: 6436 — 6436.  PubMed DOI:10.1093/nar/18.21.6436
  • Chuat J.-C., Raisonnier A., Etienne J., Galibert F. (1992). The lipoprotein lipase-encoding human gene: sequence from intron-6 to intron-9 and presence in intron-7 of a 40-million-year-old Alu sequence.. Gene 110: 257 — 261.  PubMed DOI:10.1016/0378-1119(92)90658-C
  • The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).. Genome Res. 14: 2121 — 2127. 2004.  PubMed DOI:10.1101/gr.2596504
  • Enerbaeck S., Ohlsson B.G., Samuelsson L., Bjursell G. (1992). Characterization of the human lipoprotein lipase (LPL) promoter: evidence of two cis-regulatory regions, LP-alpha and LP-beta, of importance for the differentiation-linked induction of the LPL gene during adipogenesis.. Mol. Cell. Biol. 12: 4622 — 4633.  PubMed DOI:10.1128/MCB.12.10.4622

Примітки[ред. | ред. код]

Див. також[ред. | ред. код]