Плектин

Матеріал з Вікіпедії — вільної енциклопедії.
Перейти до навігації Перейти до пошуку
Плектин
Ідентифікатори
Символи HD1plectinhemidesmosomal protein 1Plectin-1plectin 1intermediate filament binding protein 500kDaPLEC
Зовнішні ІД GeneCards: [1]
Ортологи
Види Людина Миша
Entrez
Ensembl
UniProt
RefSeq (мРНК)
н/д
н/д
RefSeq (білок)
н/д
н/д
Локус (UCSC) н/д н/д
PubMed search н/д н/д
Вікідані
Див./Ред. для людей

Плектин (англ. Plectin) – білок, який кодується геном PLEC, розташованим у людей на короткому плечі 8-ї хромосоми. [1] Довжина поліпептидного ланцюга білка становить 4 684 амінокислот, а молекулярна маса — 531 791[2].

Послідовність амінокислот
1020304050
MVAGMLMPRDQLRAIYEVLFREGVMVAKKDRRPRSLHPHVPGVTNLQVMR
AMASLRARGLVRETFAWCHFYWYLTNEGIAHLRQYLHLPPEIVPASLQRV
RRPVAMVMPARRTPHVQAVQGPLGSPPKRGPLPTEEQRVYRRKELEEVSP
ETPVVPATTQRTLARPGPEPAPATDERDRVQKKTFTKWVNKHLIKAQRHI
SDLYEDLRDGHNLISLLEVLSGDSLPREKGRMRFHKLQNVQIALDYLRHR
QVKLVNIRNDDIADGNPKLTLGLIWTIILHFQISDIQVSGQSEDMTAKEK
LLLWSQRMVEGYQGLRCDNFTSSWRDGRLFNAIIHRHKPLLIDMNKVYRQ
TNLENLDQAFSVAERDLGVTRLLDPEDVDVPQPDEKSIITYVSSLYDAMP
RVPDVQDGVRANELQLRWQEYRELVLLLLQWMRHHTAAFEERRFPSSFEE
IEILWSQFLKFKEMELPAKEADKNRSKGIYQSLEGAVQAGQLKVPPGYHP
LDVEKEWGKLHVAILEREKQLRSEFERLECLQRIVTKLQMEAGLCEEQLN
QADALLQSDVRLLAAGKVPQRAGEVERDLDKADSMIRLLFNDVQTLKDGR
HPQGEQMYRRVYRLHERLVAIRTEYNLRLKAGVAAPATQVAQVTLQSVQR
RPELEDSTLRYLQDLLAWVEENQHRVDGAEWGVDLPSVEAQLGSHRGLHQ
SIEEFRAKIERARSDEGQLSPATRGAYRDCLGRLDLQYAKLLNSSKARLR
SLESLHSFVAAATKELMWLNEKEEEEVGFDWSDRNTNMTAKKESYSALMR
ELELKEKKIKELQNAGDRLLREDHPARPTVESFQAALQTQWSWMLQLCCC
IEAHLKENAAYFQFFSDVREAEGQLQKLQEALRRKYSCDRSATVTRLEDL
LQDAQDEKEQLNEYKGHLSGLAKRAKAVVQLKPRHPAHPMRGRLPLLAVC
DYKQVEVTVHKGDECQLVGPAQPSHWKVLSSSGSEAAVPSVCFLVPPPNQ
EAQEAVTRLEAQHQALVTLWHQLHVDMKSLLAWQSLRRDVQLIRSWSLAT
FRTLKPEEQRQALHSLELHYQAFLRDSQDAGGFGPEDRLMAEREYGSCSH
HYQQLLQSLEQGAQEESRCQRCISELKDIRLQLEACETRTVHRLRLPLDK
EPARECAQRIAEQQKAQAEVEGLGKGVARLSAEAEKVLALPEPSPAAPTL
RSELELTLGKLEQVRSLSAIYLEKLKTISLVIRGTQGAEEVLRAHEEQLK
EAQAVPATLPELEATKASLKKLRAQAEAQQPTFDALRDELRGAQEVGERL
QQRHGERDVEVERWRERVAQLLERWQAVLAQTDVRQRELEQLGRQLRYYR
ESADPLGAWLQDARRRQEQIQAMPLADSQAVREQLRQEQALLEEIERHGE
KVEECQRFAKQYINAIKDYELQLVTYKAQLEPVASPAKKPKVQSGSESVI
QEYVDLRTHYSELTTLTSQYIKFISETLRRMEEEERLAEQQRAEERERLA
EVEAALEKQRQLAEAHAQAKAQAEREAKELQQRMQEEVVRREEAAVDAQQ
QKRSIQEELQQLRQSSEAEIQAKARQAEAAERSRLRIEEEIRVVRLQLEA
TERQRGGAEGELQALRARAEEAEAQKRQAQEEAERLRRQVQDESQRKRQA
EVELASRVKAEAEAAREKQRALQALEELRLQAEEAERRLRQAEVERARQV
QVALETAQRSAEAELQSKRASFAEKTAQLERSLQEEHVAVAQLREEAERR
AQQQAEAERAREEAERELERWQLKANEALRLRLQAEEVAQQKSLAQAEAE
KQKEEAEREARRRGKAEEQAVRQRELAEQELEKQRQLAEGTAQQRLAAEQ
ELIRLRAETEQGEQQRQLLEEELARLQREAAAATQKRQELEAELAKVRAE
MEVLLASKARAEEESRSTSEKSKQRLEAEAGRFRELAEEAARLRALAEEA
KRQRQLAEEDAARQRAEAERVLAEKLAAIGEATRLKTEAEIALKEKEAEN
ERLRRLAEDEAFQRRRLEEQAAQHKADIEERLAQLRKASDSELERQKGLV
EDTLRQRRQVEEEILALKASFEKAAAGKAELELELGRIRSNAEDTLRSKE
QAELEAARQRQLAAEEERRRREAEERVQKSLAAEEEAARQRKAALEEVER
LKAKVEEARRLRERAEQESARQLQLAQEAAQKRLQAEEKAHAFAVQQKEQ
ELQQTLQQEQSVLDQLRGEAEAARRAAEEAEEARVQAEREAAQSRRQVEE
AERLKQSAEEQAQARAQAQAAAEKLRKEAEQEAARRAQAEQAALRQKQAA
DAEMEKHKKFAEQTLRQKAQVEQELTTLRLQLEETDHQKNLLDEELQRLK
AEATEAARQRSQVEEELFSVRVQMEELSKLKARIEAENRALILRDKDNTQ
RFLQEEAEKMKQVAEEAARLSVAAQEAARLRQLAEEDLAQQRALAEKMLK
EKMQAVQEATRLKAEAELLQQQKELAQEQARRLQEDKEQMAQQLAEETQG
FQRTLEAERQRQLEMSAEAERLKLRVAEMSRAQARAEEDAQRFRKQAEEI
GEKLHRTELATQEKVTLVQTLEIQRQQSDHDAERLREAIAELEREKEKLQ
QEAKLLQLKSEEMQTVQQEQLLQETQALQQSFLSEKDSLLQRERFIEQEK
AKLEQLFQDEVAKAQQLREEQQRQQQQMEQERQRLVASMEEARRRQHEAE
EGVRRKQEELQQLEQQRRQQEELLAEENQRLREQLQLLEEQHRAALAHSE
EVTASQVAATKTLPNGRDALDGPAAEAEPEHSFDGLRRKVSAQRLQEAGI
LSAEELQRLAQGHTTVDELARREDVRHYLQGRSSIAGLLLKATNEKLSVY
AALQRQLLSPGTALILLEAQAASGFLLDPVRNRRLTVNEAVKEGVVGPEL
HHKLLSAERAVTGYKDPYTGQQISLFQAMQKGLIVREHGIRLLEAQIATG
GVIDPVHSHRVPVDVAYRRGYFDEEMNRVLADPSDDTKGFFDPNTHENLT
YLQLLERCVEDPETGLCLLPLTDKAAKGGELVYTDSEARDVFEKATVSAP
FGKFQGKTVTIWEIINSEYFTAEQRRDLLRQFRTGRITVEKIIKIIITVV
EEQEQKGRLCFEGLRSLVPAAELLESRVIDRELYQQLQRGERSVRDVAEV
DTVRRALRGANVIAGVWLEEAGQKLSIYNALKKDLLPSDMAVALLEAQAG
TGHIIDPATSARLTVDEAVRAGLVGPEFHEKLLSAEKAVTGYRDPYTGQS
VSLFQALKKGLIPREQGLRLLDAQLSTGGIVDPSKSHRVPLDVACARGCL
DEETSRALSAPRADAKAYSDPSTGEPATYGELQQRCRPDQLTGLSLLPLS
EKAARARQEELYSELQARETFEKTPVEVPVGGFKGRTVTVWELISSEYFT
AEQRQELLRQFRTGKVTVEKVIKILITIVEEVETLRQERLSFSGLRAPVP
ASELLASGVLSRAQFEQLKDGKTTVKDLSELGSVRTLLQGSGCLAGIYLE
DTKEKVSIYEAMRRGLLRATTAALLLEAQAATGFLVDPVRNQRLYVHEAV
KAGVVGPELHEQLLSAEKAVTGYRDPYSGSTISLFQAMQKGLVLRQHGIR
LLEAQIATGGIIDPVHSHRVPVDVAYQRGYFSEEMNRVLADPSDDTKGFF
DPNTHENLTYRQLLERCVEDPETGLRLLPLKGAEKAEVVETTQVYTEEET
RRAFEETQIDIPGGGSHGGSTMSLWEVMQSDLIPEEQRAQLMADFQAGRV
TKERMIIIIIEIIEKTEIIRQQGLASYDYVRRRLTAEDLFEARIISLETY
NLLREGTRSLREALEAESAWCYLYGTGSVAGVYLPGSRQTLSIYQALKKG
LLSAEVARLLLEAQAATGFLLDPVKGERLTVDEAVRKGLVGPELHDRLLS
AERAVTGYRDPYTEQTISLFQAMKKELIPTEEALRLLDAQLATGGIVDPR
LGFHLPLEVAYQRGYLNKDTHDQLSEPSEVRSYVDPSTDERLSYTQLLRR
CRRDDGTGQLLLPLSDARKLTFRGLRKQITMEELVRSQVMDEATALQLRE
GLTSIEEVTKNLQKFLEGTSCIAGVFVDATKERLSVYQAMKKGIIRPGTA
FELLEAQAATGYVIDPIKGLKLTVEEAVRMGIVGPEFKDKLLSAERAVTG
YKDPYSGKLISLFQAMKKGLILKDHGIRLLEAQIATGGIIDPEESHRLPV
EVAYKRGLFDEEMNEILTDPSDDTKGFFDPNTEENLTYLQLMERCITDPQ
TGLCLLPLKEKKRERKTSSKSSVRKRRVVIVDPETGKEMSVYEAYRKGLI
DHQTYLELSEQECEWEEITISSSDGVVKSMIIDRRSGRQYDIDDAIAKNL
IDRSALDQYRAGTLSITEFADMLSGNAGGFRSRSSSVGSSSSYPISPAVS
RTQLASWSDPTEETGPVAGILDTETLEKVSITEAMHRNLVDNITGQRLLE
AQACTGGIIDPSTGERFPVTDAVNKGLVDKIMVDRINLAQKAFCGFEDPR
TKTKMSAAQALKKGWLYYEAGQRFLEVQYLTGGLIEPDTPGRVPLDEALQ
RGTVDARTAQKLRDVGAYSKYLTCPKTKLKISYKDALDRSMVEEGTGLRL
LEAAAQSTKGYYSPYSVSGSGSTAGSRTGSRTGSRAGSRRGSFDATGSGF
SMTFSSSSYSSSGYGRRYASGSSASLGGPESAVA

Білок має сайт для зв'язування з молекулою актину. Локалізований у цитоплазмі, цитоскелеті, клітинних контактах.

Література[ред. | ред. код]

  • Liu C.-G., Maercker C., Castanon M.J., Hauptmann R., Wiche G. (1996). Human plectin: organization of the gene, sequence analysis, and chromosome localization (8q24).. Proc. Natl. Acad. Sci. U.S.A. 93: 4278 — 4283.  PubMed DOI:10.1073/pnas.93.9.4278
  • Zhang T., Haws P., Wu Q. (2004). Multiple variable first exons: a mechanism for cell- and tissue-specific gene regulation.. Genome Res. 14: 79 — 89.  PubMed DOI:10.1101/gr.1225204
  • Koster J., Geerts D., Favre B., Borradori L., Sonnenberg A. (2003). Analysis of the interactions between BP180, BP230, plectin and the integrin alpha6beta4 important for hemidesmosome assembly.. J. Cell Sci. 116: 387 — 399.  PubMed DOI:10.1242/jcs.00241
  • Carrascal M., Ovelleiro D., Casas V., Gay M., Abian J. (2008). Phosphorylation analysis of primary human T lymphocytes using sequential IMAC and titanium oxide enrichment.. J. Proteome Res. 7: 5167 — 5176.  PubMed DOI:10.1021/pr800500r
  • Maiweilidan Y., Klauza I., Kordeli E. (2011). Novel interactions of ankyrins-G at the costameres: the muscle-specific Obscurin/Titin-Binding-related Domain (OTBD) binds plectin and filamin C.. Exp. Cell Res. 317: 724 — 736.  PubMed DOI:10.1016/j.yexcr.2011.01.002
  • Sonnenberg A., Rojas A.M., de Pereda J.M. (2007). The structure of a tandem pair of spectrin repeats of plectin reveals a modular organization of the plakin domain.. J. Mol. Biol. 368: 1379 — 1391.  PubMed DOI:10.1016/j.jmb.2007.02.090

Примітки[ред. | ред. код]

  1. HUGO Gene Nomenclature Commitee, HGNC:9069 (англ.). Процитовано 6 лютого 2017. 
  2. UniProt, Q15149 (англ.). Процитовано 6 лютого 2017. 

Див. також[ред. | ред. код]