Синтаза жирних кислот

Матеріал з Вікіпедії — вільної енциклопедії.
Перейти до навігації Перейти до пошуку
Синтаза жирних кислот
Protein FASN PDB 1xkt.png
Наявні структури
PDBПошук ортологів: PDBe RCSB
Ідентифікатори
Символи FASN, fatty acid synthase, Fasn, A630082H08Rik, FAS, OA-519, SDR27X1, Fatty acid synthase
Зовнішні ІД MGI: 95485 HomoloGene: 55800 GeneCards: FASN
Шаблон експресії
PBB GE FASN 217006 x at fs.png

PBB GE FASN 212218 s at fs.png
Більше даних
Ортологи
Види Людина Миша
Entrez
Ensembl
UniProt
RefSeq (мРНК)
NM_004104
NM_007988
RefSeq (білок)
NP_004095
NP_032014
Локус (UCSC) Хр. 17: 82.08 – 82.1 Mb Хр. 11: 120.81 – 120.82 Mb
PubMed search [1] [2]
Вікідані
Див./Ред. для людейДив./Ред. для мишей

Синтаза жирних кислот (англ. Fatty acid synthase) – білок, який кодується геном FASN, розташованим у людей на короткому плечі 17-ї хромосоми. [3] Довжина поліпептидного ланцюга білка становить 2 511 амінокислот, а молекулярна маса — 273 427[4].

Послідовність амінокислот
1020304050
MEEVVIAGMSGKLPESENLQEFWDNLIGGVDMVTDDDRRWKAGLYGLPRR
SGKLKDLSRFDASFFGVHPKQAHTMDPQLRLLLEVTYEAIVDGGINPDSL
RGTHTGVWVGVSGSETSEALSRDPETLVGYSMVGCQRAMMANRLSFFFDF
RGPSIALDTACSSSLMALQNAYQAIHSGQCPAAIVGGINVLLKPNTSVQF
LRLGMLSPEGTCKAFDTAGNGYCRSEGVVAVLLTKKSLARRVYATILNAG
TNTDGFKEQGVTFPSGDIQEQLIRSLYQSAGVAPESFEYIEAHGTGTKVG
DPQELNGITRALCATRQEPLLIGSTKSNMGHPEPASGLAALAKVLLSLEH
GLWAPNLHFHSPNPEIPALLDGRLQVVDQPLPVRGGNVGINSFGFGGSNV
HIILRPNTQPPPAPAPHATLPRLLRASGRTPEAVQKLLEQGLRHSQDLAF
LSMLNDIAAVPATAMPFRGYAVLGGERGGPEVQQVPAGERPLWFICSGMG
TQWRGMGLSLMRLDRFRDSILRSDEAVKPFGLKVSQLLLSTDESTFDDIV
HSFVSLTAIQIGLIDLLSCMGLRPDGIVGHSLGEVACGYADGCLSQEEAV
LAAYWRGQCIKEAHLPPGAMAAVGLSWEECKQRCPPGVVPACHNSKDTVT
ISGPQAPVFEFVEQLRKEGVFAKEVRTGGMAFHSYFMEAIAPPLLQELKK
VIREPKPRSARWLSTSIPEAQWHSSLARTSSAEYNVNNLVSPVLFQEALW
HVPEHAVVLEIAPHALLQAVLKRGLKPSCTIIPLMKKDHRDNLEFFLAGI
GRLHLSGIDANPNALFPPVEFPAPRGTPLISPLIKWDHSLAWDVPAAEDF
PNGSGSPSAAIYNIDTSSESPDHYLVDHTLDGRVLFPATGYLSIVWKTLA
RALGLGVEQLPVVFEDVVLHQATILPKTGTVSLEVRLLEASRAFEVSENG
NLVVSGKVYQWDDPDPRLFDHPESPTPNPTEPLFLAQAEVYKELRLRGYD
YGPHFQGILEASLEGDSGRLLWKDNWVSFMDTMLQMSILGSAKHGLYLPT
RVTAIHIDPATHRQKLYTLQDKAQVADVVVSRWLRVTVAGGVHISGLHTE
SAPRRQQEQQVPILEKFCFTPHTEEGCLSERAALQEELQLCKGLVQALQT
KVTQQGLKMVVPGLDGAQIPRDPSQQELPRLLSAACRLQLNGNLQLELAQ
VLAQERPKLPEDPLLSGLLDSPALKACLDTAVENMPSLKMKVVEVLAGHG
HLYSRIPGLLSPHPLLQLSYTATDRHPQALEAAQAELQQHDVAQGQWDPA
DPAPSALGSADLLVCNCAVAALGDPASALSNMVAALREGGFLLLHTLLRG
HPLGDIVAFLTSTEPQYGQGILSQDAWESLFSRVSLRLVGLKKSFYGSTL
FLCRRPTPQDSPIFLPVDDTSFRWVESLKGILADEDSSRPVWLKAINCAT
SGVVGLVNCLRREPGGNRLRCVLLSNLSSTSHVPEVDPGSAELQKVLQGD
LVMNVYRDGAWGAFRHFLLEEDKPEEPTAHAFVSTLTRGDLSSIRWVCSS
LRHAQPTCPGAQLCTVYYASLNFRDIMLATGKLSPDAIPGKWTSQDSLLG
MEFSGRDASGKRVMGLVPAKGLATSVLLSPDFLWDVPSNWTLEEAASVPV
VYSTAYYALVVRGRVRPGETLLIHSGSGGVGQAAIAIALSLGCRVFTTVG
SAEKRAYLQARFPQLDSTSFANSRDTSFEQHVLWHTGGKGVDLVLNSLAE
EKLQASVRCLATHGRFLEIGKFDLSQNHPLGMAIFLKNVTFHGVLLDAFF
NESSADWREVWALVQAGIRDGVVRPLKCTVFHGAQVEDAFRYMAQGKHIG
KVVVQVLAEEPEAVLKGAKPKLMSAISKTFCPAHKSYIIAGGLGGFGLEL
AQWLIQRGVQKLVLTSRSGIRTGYQAKQVRRWRRQGVQVQVSTSNISSLE
GARGLIAEAAQLGPVGGVFNLAVVLRDGLLENQTPEFFQDVCKPKYSGTL
NLDRVTREACPELDYFVVFSSVSCGRGNAGQSNYGFANSAMERICEKRRH
EGLPGLAVQWGAIGDVGILVETMSTNDTIVSGTLPQRMASCLEVLDLFLN
QPHMVLSSFVLAEKAAAYRDRDSQRDLVEAVAHILGIRDLAAVNLDSSLA
DLGLDSLMSVEVRQTLERELNLVLSVREVRQLTLRKLQELSSKADEASEL
ACPTPKEDGLAQQQTQLNLRSLLVNPEGPTLMRLNSVQSSERPLFLVHPI
EGSTTVFHSLASRLSIPTYGLQCTRAAPLDSIHSLAAYYIDCIRQVQPEG
PYRVAGYSYGACVAFEMCSQLQAQQSPAPTHNSLFLFDGSPTYVLAYTQS
YRAKLTPGCEAEAETEAICFFVQQFTDMEHNRVLEALLPLKGLEERVAAA
VDLIIKSHQGLDRQELSFAARSFYYKLRAAEQYTPKAKYHGNVMLLRAKT
GGAYGEDLGADYNLSQVCDGKVSVHVIEGDHRTLLEGSGLESIISIIHSS
LAEPRVSVREG

Цей білок за функціями належить до оксидоредуктаз, трансфераз, ліаз, гідролаз. Задіяний у таких біологічних процесах як метаболізм жирних кислот, метаболізм ліпідів, біосинтез жирних кислот, біосинтез ліпідів. Білок має сайт для зв'язування з НАД, НАДФ, піридоксаль-фосфатом. Локалізований у цитоплазмі.

Література[ред. | ред. код]

  • The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).. Genome Res. 14: 2121 — 2127. 2004.  PubMed DOI:10.1101/gr.2596504
  • Beausoleil S.A., Villen J., Gerber S.A., Rush J., Gygi S.P. (2006). A probability-based approach for high-throughput protein phosphorylation analysis and site localization.. Nat. Biotechnol. 24: 1285 — 1292.  PubMed DOI:10.1038/nbt1240
  • Impens F., Radoshevich L., Cossart P., Ribet D. (2014). Mapping of SUMO sites and analysis of SUMOylation changes induced by external stimuli.. Proc. Natl. Acad. Sci. U.S.A. 111: 12432 — 12437.  PubMed DOI:10.1073/pnas.1413825111
  • Chakravarty B., Gu Z., Chirala S.S., Wakil S.J., Quiocho F.A. (2004). Human fatty acid synthase: structure and substrate selectivity of the thioesterase domain.. Proc. Natl. Acad. Sci. U.S.A. 101: 15567 — 15572.  PubMed DOI:10.1073/pnas.0406901101
  • Pemble C.W. IV, Johnson L.C., Kridel S.J., Lowther W.T. (2007). Crystal structure of the thioesterase domain of human fatty acid synthase inhibited by Orlistat.. Nat. Struct. Mol. Biol. 14: 704 — 709.  PubMed DOI:10.1038/nsmb1265
  • Semenkovich C.F., Coleman T., Fiedorek F.T. Jr. (1995). Human fatty acid synthase mRNA: tissue distribution, genetic mapping, and kinetics of decay after glucose deprivation.. J. Lipid Res. 36: 1507 — 1521.  PubMed

Примітки[ред. | ред. код]

  1. Human PubMed Reference:. 
  2. Mouse PubMed Reference:. 
  3. HUGO Gene Nomenclature Commitee, HGNC:3594 (англ.). Процитовано 30 січня 2017. 
  4. UniProt, P49327 (англ.). Процитовано 30 січня 2017. 

Див. також[ред. | ред. код]