Тимопоетин

Матеріал з Вікіпедії — вільної енциклопедії.
Перейти до навігації Перейти до пошуку
Тимопоетин
Ідентифікатори
Символи thymopoietin-related peptide isoform alphathymopoietin-related peptide isoforms beta/gammaTMPOTP beta/gammathymopoietinTPRP isoform alphaThymopoietin isoform alphalamina-associated polypeptide 2TP alphaLEM domain containing 4thymopoietin beta
Зовнішні ІД GeneCards: [1]
Шаблон експресії
PBB GE TMPO 209753 s at fs.png
Більше даних
Ортологи
Види Людина Миша
Entrez
Ensembl
UniProt
RefSeq (мРНК)
н/д
н/д
RefSeq (білок)
н/д
н/д
Локус (UCSC) н/д н/д
PubMed search н/д н/д
Вікідані
Див./Ред. для людей

TMPO (англ. Thymopoietin) – білок, який кодується однойменним геном, розташованим у людей на короткому плечі 12-ї хромосоми.[1] Довжина поліпептидного ланцюга білка становить 694 амінокислот, а молекулярна маса — 75 492[2].

Послідовність амінокислот
1020304050
MPEFLEDPSVLTKDKLKSELVANNVTLPAGEQRKDVYVQLYLQHLTARNR
PPLPAGTNSKGPPDFSSDEEREPTPVLGSGAAAAGRSRAAVGRKATKKTD
KPRQEDKDDLDVTELTNEDLLDQLVKYGVNPGPIVGTTRKLYEKKLLKLR
EQGTESRSSTPLPTISSSAENTRQNGSNDSDRYSDNEEGKKKEHKKVKST
RDIVPFSELGTTPSGGGFFQGISFPEISTRPPLGSTELQAAKKVHTSKGD
LPREPLVATNLPGRGQLQKLASERNLFISCKSSHDRCLEKSSSSSSQPEH
SAMLVSTAASPSLIKETTTGYYKDIVENICGREKSGIQPLCPERSHISDQ
SPLSSKRKALEESESSQLISPPLAQAIRDYVNSLLVQGGVGSLPGTSNSM
PPLDVENIQKRIDQSKFQETEFLSPPRKVPRLSEKSVEERDSGSFVAFQN
IPGSELMSSFAKTVVSHSLTTLGLEVAKQSQHDKIDASELSFPFHESILK
VIEEEWQQVDRQLPSLACKYPVSSREATQILSVPKVDDEILGFISEATPL
GGIQAASTESCNQQLDLALCRAYEAAASALQIATHTAFVAKAMQADISQA
AQILSSDPSRTHQALGILSKTYDAASYICEAAFDEVKMAAHTMGNATVGR
RYLWLKDCKINLASKNKLASTPFKGGTLFGGEVCKVIKKRGNKH

Кодований геном білок за функцією належить до фосфопротеїнів. Задіяний у таких біологічних процесах, як ацетилювання, альтернативний сплайсинг. Білок має сайт для зв'язування з ДНК. Локалізований у ядрі, хромосомах.

Література[ред. | ред. код]

  • Harris C.A., Andryuk P.J., Cline S.W., Siekierka J.J., Goldstein G. (1995). Structure and mapping of the human thymopoietin (TMPO) gene and relationship of human TMPO beta to rat lamin-associated polypeptide 2.. Genomics 28: 198 — 205.  PubMed DOI:10.1006/geno.1995.1131
  • Audhya T., Schlesinger D.H., Goldstein G. (1987). Isolation and complete amino acid sequence of human thymopoietin and splenin.. Proc. Natl. Acad. Sci. U.S.A. 84: 3545 — 3549.  PubMed DOI:10.1073/pnas.84.11.3545
  • Goldstein G., Schlesinger D.H., Audhya T. (1994). Proc. Natl. Acad. Sci. U.S.A. 91: 6249 — 6249.  PubMed DOI:10.1073/pnas.91.13.6249
  • Markiewicz E., Dechat T., Foisner R., Quinlan R.A., Hutchison C.J. (2002). Lamin A/C binding protein LAP2alpha is required for nuclear anchorage of retinoblastoma protein.. Mol. Biol. Cell 13: 4401 — 4413.  PubMed DOI:10.1091/mbc.E02-07-0450
  • Giorgianni F., Zhao Y., Desiderio D.M., Beranova-Giorgianni S. (2007). Toward a global characterization of the phosphoproteome in prostate cancer cells: identification of phosphoproteins in the LNCaP cell line.. Electrophoresis 28: 2027 — 2034.  PubMed DOI:10.1002/elps.200600782
  • Carrascal M., Ovelleiro D., Casas V., Gay M., Abian J. (2008). Phosphorylation analysis of primary human T lymphocytes using sequential IMAC and titanium oxide enrichment.. J. Proteome Res. 7: 5167 — 5176.  PubMed DOI:10.1021/pr800500r

Примітки[ред. | ред. код]

  1. HUGO Gene Nomenclature Commitee, HGNC:11875 (англ.). Процитовано 11 вересня 2017. 
  2. UniProt, P42166 (англ.). Процитовано 11 вересня 2017. 

Див. також[ред. | ред. код]