Філамін C

Матеріал з Вікіпедії — вільної енциклопедії.
Перейти до навігації Перейти до пошуку
Філамін C
Protein FLNC PDB 1v05.png
Наявні структури
PDBПошук ортологів: PDBe RCSB
Ідентифікатори
Символи FLNC, ABP-280, ABP280A, ABPA, ABPL, FLN2, MFM5, MPD4, filamin C, RCM5, CMH26
Зовнішні ІД OMIM: 102565 MGI: 95557 HomoloGene: 37481 GeneCards: FLNC
Пов'язані генетичні захворювання
myofibrillar myopathy 5, hypertrophic cardiomyopathy 26[1]
Шаблон експресії
PBB GE FLNC 207876 s at fs.png
Більше даних
Ортологи
Види Людина Миша
Entrez
Ensembl
UniProt
RefSeq (мРНК)
NM_001458
NM_001127487
NM_001081185
NM_001311074
NM_026839
RefSeq (білок)
NP_001120959
NP_001449
NP_001074654
NP_001298003
Локус (UCSC) Хр. 7: 128.83 – 128.86 Mb Хр. 6: 29.43 – 29.46 Mb
PubMed search [2] [3]
Вікідані
Див./Ред. для людейДив./Ред. для мишей

Філамін C (англ. Filamin C) – білок, який кодується геном FLNC, розташованим у людей на короткому плечі 7-ї хромосоми. [4] Довжина поліпептидного ланцюга білка становить 2 725 амінокислот, а молекулярна маса — 291 022[5].

Послідовність амінокислот
1020304050
MMNNSGYSDAGLGLGDETDEMPSTEKDLAEDAPWKKIQQNTFTRWCNEHL
KCVGKRLTDLQRDLSDGLRLIALLEVLSQKRMYRKFHPRPNFRQMKLENV
SVALEFLEREHIKLVSIDSKAIVDGNLKLILGLIWTLILHYSISMPMWED
EDDEDARKQTPKQRLLGWIQNKVPQLPITNFNRDWQDGKALGALVDNCAP
GLCPDWEAWDPNQPVENAREAMQQADDWLGVPQVIAPEEIVDPNVDEHSV
MTYLSQFPKAKLKPGAPVRSKQLNPKKAIAYGPGIEPQGNTVLQPAHFTV
QTVDAGVGEVLVYIEDPEGHTEEAKVVPNNDKDRTYAVSYVPKVAGLHKV
TVLFAGQNIERSPFEVNVGMALGDANKVSARGPGLEPVGNVANKPTYFDI
YTAGAGTGDVAVVIVDPQGRRDTVEVALEDKGDSTFRCTYRPAMEGPHTV
HVAFAGAPITRSPFPVHVSEACNPNACRASGRGLQPKGVRVKEVADFKVF
TKGAGSGELKVTVKGPKGTEEPVKVREAGDGVFECEYYPVVPGKYVVTIT
WGGYAIPRSPFEVQVSPEAGVQKVRAWGPGLETGQVGKSADFVVEAIGTE
VGTLGFSIEGPSQAKIECDDKGDGSCDVRYWPTEPGEYAVHVICDDEDIR
DSPFIAHILPAPPDCFPDKVKAFGPGLEPTGCIVDKPAEFTIDARAAGKG
DLKLYAQDADGCPIDIKVIPNGDGTFRCSYVPTKPIKHTIIISWGGVNVP
KSPFRVNVGEGSHPERVKVYGPGVEKTGLKANEPTYFTVDCSEAGQGDVS
IGIKCAPGVVGPAEADIDFDIIKNDNDTFTVKYTPPGAGRYTIMVLFANQ
EIPASPFHIKVDPSHDASKVKAEGPGLNRTGVEVGKPTHFTVLTKGAGKA
KLDVQFAGTAKGEVVRDFEIIDNHDYSYTVKYTAVQQGNMAVTVTYGGDP
VPKSPFVVNVAPPLDLSKIKVQGLNSKVAVGQEQAFSVNTRGAGGQGQLD
VRMTSPSRRPIPCKLEPGGGAEAQAVRYMPPEEGPYKVDITYDGHPVPGS
PFAVEGVLPPDPSKVCAYGPGLKGGLVGTPAPFSIDTKGAGTGGLGLTVE
GPCEAKIECQDNGDGSCAVSYLPTEPGEYTINILFAEAHIPGSPFKATIR
PVFDPSKVRASGPGLERGKVGEAATFTVDCSEAGEAELTIEILSDAGVKA
EVLIHNNADGTYHITYSPAFPGTYTITIKYGGHPVPKFPTRVHVQPAVDT
SGVKVSGPGVEPHGVLREVTTEFTVDARSLTATGGNHVTARVLNPSGAKT
DTYVTDNGDGTYRVQYTAYEEGVHLVEVLYDEVAVPKSPFRVGVTEGCDP
TRVRAFGPGLEGGLVNKANRFTVETRGAGTGGLGLAIEGPSEAKMSCKDN
KDGSCTVEYIPFTPGDYDVNITFGGRPIPGSPFRVPVKDVVDPGKVKCSG
PGLGAGVRARVPQTFTVDCSQAGRAPLQVAVLGPTGVAEPVEVRDNGDGT
HTVHYTPATDGPYTVAVKYADQEVPRSPFKIKVLPAHDASKVRASGPGLN
ASGIPASLPVEFTIDARDAGEGLLTVQILDPEGKPKKANIRDNGDGTYTV
SYLPDMSGRYTITIKYGGDEIPYSPFRIHALPTGDASKCLVTVSIGGHGL
GACLGPRIQIGQETVITVDAKAAGEGKVTCTVSTPDGAELDVDVVENHDG
TFDIYYTAPEPGKYVITIRFGGEHIPNSPFHVLACDPLPHEEEPSEVPQL
RQPYAPPRPGARPTHWATEEPVVPVEPMESMLRPFNLVIPFAVQKGELTG
EVRMPSGKTARPNITDNKDGTITVRYAPTEKGLHQMGIKYDGNHIPGSPL
QFYVDAINSRHVSAYGPGLSHGMVNKPATFTIVTKDAGEGGLSLAVEGPS
KAEITCKDNKDGTCTVSYLPTAPGDYSIIVRFDDKHIPGSPFTAKITGDD
SMRTSQLNVGTSTDVSLKITESDLSQLTASIRAPSGNEEPCLLKRLPNRH
IGISFTPKEVGEHVVSVRKSGKHVTNSPFKILVGPSEIGDASKVRVWGKG
LSEGHTFQVAEFIVDTRNAGYGGLGLSIEGPSKVDINCEDMEDGTCKVTY
CPTEPGTYIINIKFADKHVPGSPFTVKVTGEGRMKESITRRRQAPSIATI
GSTCDLNLKIPGNWFQMVSAQERLTRTFTRSSHTYTRTERTEISKTRGGE
TKREVRVEESTQVGGDPFPAVFGDFLGRERLGSFGSITRQQEGEASSQDM
TAQVTSPSGKVEAAEIVEGEDSAYSVRFVPQEMGPHTVAVKYRGQHVPGS
PFQFTVGPLGEGGAHKVRAGGTGLERGVAGVPAEFSIWTREAGAGGLSIA
VEGPSKAEIAFEDRKDGSCGVSYVVQEPGDYEVSIKFNDEHIPDSPFVVP
VASLSDDARRLTVTSLQETGLKVNQPASFAVQLNGARGVIDARVHTPSGA
VEECYVSELDSDKHTIRFIPHENGVHSIDVKFNGAHIPGSPFKIRVGEQS
QAGDPGLVSAYGPGLEGGTTGVSSEFIVNTLNAGSGALSVTIDGPSKVQL
DCRECPEGHVVTYTPMAPGNYLIAIKYGGPQHIVGSPFKAKVTGPRLSGG
HSLHETSTVLVETVTKSSSSRGSSYSSIPKFSSDASKVVTRGPGLSQAFV
GQKNSFTVDCSKAGTNMMMVGVHGPKTPCEEVYVKHMGNRVYNVTYTVKE
KGDYILIVKWGDESVPGSPFKVKVP

Білок має сайт для зв'язування з молекулою актину. Локалізований у цитоплазмі, цитоскелеті, мембрані.

Література[ред. | ред. код]

  • Xie Z.-W., Xu W.-F., Davie E.W., Chung D.W. (1998). Molecular cloning of human ABPL, an actin-binding protein homologue.. Biochem. Biophys. Res. Commun. 251: 914 — 919.  PubMed DOI:10.1006/bbrc.1998.9506
  • Frey N., Olson E.N. (2002). Calsarcin-3, a novel skeletal muscle-specific member of the calsarcin family, interacts with multiple Z-disc proteins.. J. Biol. Chem. 277: 13998 — 14004.  PubMed DOI:10.1074/jbc.M200712200
  • Himmel M., van der Ven P.F.M., Stoecklein W., Fuerst D.O. (2003). The limits of promiscuity: isoform-specific dimerization of filamins.. Biochemistry 42: 430 — 439.  PubMed DOI:10.1021/bi026501+
  • Bosch-Comas A., Lindsten K., Gonzalez-Duarte R., Masucci M.G., Marfany G. (2006). The ubiquitin-specific protease USP25 interacts with three sarcomeric proteins.. Cell. Mol. Life Sci. 63: 723 — 734.  PubMed DOI:10.1007/s00018-005-5533-1
  • Maiweilidan Y., Klauza I., Kordeli E. (2011). Novel interactions of ankyrins-G at the costameres: the muscle-specific Obscurin/Titin-Binding-related Domain (OTBD) binds plectin and filamin C.. Exp. Cell Res. 317: 724 — 736.  PubMed DOI:10.1016/j.yexcr.2011.01.002
  • Pudas R., Kiema T.-R., Butler P.J.G., Stewart M., Ylaenne J. (2005). Structural basis for vertebrate filamin dimerization.. Structure 13: 111 — 119.  PubMed DOI:10.1016/j.str.2004.10.014

Примітки[ред. | ред. код]

Див. також[ред. | ред. код]