Циклін-залежна кіназа 4

Матеріал з Вікіпедії — вільної енциклопедії.
Перейти до навігації Перейти до пошуку
CDK4
Protein CDK4 PDB 1LD2.png
Наявні структури
PDBПошук ортологів: PDBe RCSB
Ідентифікатори
Символи CDK4, CMM3, PSK-J3, cyclin-dependent kinase 4, cyclin dependent kinase 4
Зовнішні ІД OMIM: 123829 MGI: 88357 HomoloGene: 55429 GeneCards: CDK4
Реагує на сполуку
alvocidib, palbociclib[1]
Шаблон експресії
PBB GE CDK4 202246 s at fs.png
Більше даних
Ортологи
Види Людина Миша
Entrez
Ensembl
UniProt
RefSeq (мРНК)
NM_052984
NM_000075
NM_009870
NM_001355005
RefSeq (білок)
NP_000066
NP_034000
NP_001341934
Локус (UCSC) Хр. 12: 57.75 – 57.76 Mb Хр. 10: 127.06 – 127.07 Mb
PubMed search [2] [3]
Вікідані
Див./Ред. для людейДив./Ред. для мишей

CDK4 (англ. Cyclin dependent kinase 4) – білок, який кодується однойменним геном, розташованим у людей на короткому плечі 12-ї хромосоми.[4] Довжина поліпептидного ланцюга білка становить 303 амінокислот, а молекулярна маса — 33 730[5].

Послідовність амінокислот
1020304050
MATSRYEPVAEIGVGAYGTVYKARDPHSGHFVALKSVRVPNGGGGGGGLP
ISTVREVALLRRLEAFEHPNVVRLMDVCATSRTDREIKVTLVFEHVDQDL
RTYLDKAPPPGLPAETIKDLMRQFLRGLDFLHANCIVHRDLKPENILVTS
GGTVKLADFGLARIYSYQMALTPVVVTLWYRAPEVLLQSTYATPVDMWSV
GCIFAEMFRRKPLFCGNSEADQLGKIFDLIGLPPEDDWPRDVSLPRGAFP
PRGPRPVQSVVPEMEESGAQLLLEMLTFNPHKRISAFRALQHSYLHKDEG
NPE

Кодований геном білок за функціями належить до трансфераз, кіназ, серин/треонінових протеїнкіназ, фосфопротеїнів. Задіяний у таких біологічних процесах, як клітинний цикл, поділ клітини, ацетилювання, альтернативний сплайсинг. Білок має сайт для зв'язування з АТФ, нуклеотидами. Локалізований у цитоплазмі, ядрі, мембрані.

Література[ред. | ред. код]

  • The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).. Genome Res. 14: 2121 — 2127. 2004.  PubMed DOI:10.1101/gr.2596504
  • Hanks S.K. (1987). Homology probing: identification of cDNA clones encoding members of the protein-serine kinase family.. Proc. Natl. Acad. Sci. U.S.A. 84: 388 — 392.  PubMed DOI:10.1073/pnas.84.2.388
  • Wang G.L., Iakova P., Wilde M., Awad S., Timchenko N.A. (2004). Liver tumors escape negative control of proliferation via PI3K/Akt-mediated block of C/EBP alpha growth inhibitory activity.. Genes Dev. 18: 912 — 925.  PubMed DOI:10.1101/gad.1183304
  • Zhang T., Liu W.D., Saunee N.A., Breslin M.B., Lan M.S. (2009). Zinc finger transcription factor INSM1 interrupts cyclin D1 and CDK4 binding and induces cell cycle arrest.. J. Biol. Chem. 284: 5574 — 5581.  PubMed DOI:10.1074/jbc.M808843200
  • Ray A., James M.K., Larochelle S., Fisher R.P., Blain S.W. (2009). p27Kip1 inhibits cyclin D-cyclin-dependent kinase 4 by two independent modes.. Mol. Cell. Biol. 29: 986 — 999.  PubMed DOI:10.1128/MCB.00898-08
  • Bockstaele L., Bisteau X., Paternot S., Roger P.P. (2009). Differential regulation of cyclin-dependent kinase 4 (CDK4) and CDK6, evidence that CDK4 might not be activated by CDK7, and design of a CDK6 activating mutation.. Mol. Cell. Biol. 29: 4188 — 4200.  PubMed DOI:10.1128/MCB.01823-08

Примітки[ред. | ред. код]

Див. також[ред. | ред. код]