Циклін A2

Матеріал з Вікіпедії — вільної енциклопедії.
Перейти до навігації Перейти до пошуку
CCNA2
Protein CCNA2 PDB 1e9h.png
Наявні структури
PDBПошук ортологів: PDBe RCSB
Ідентифікатори
Символи CCNA2, CCN1, CCNA, cyclin A2
Зовнішні ІД OMIM: 123835 MGI: 108069 HomoloGene: 55562 GeneCards: CCNA2
Шаблон експресії
PBB GE CCNA2 213226 at fs.png

PBB GE CCNA2 203418 at fs.png
Більше даних
Ортологи
Види Людина Миша
Entrez
Ensembl
UniProt
RefSeq (мРНК)
NM_001237
NM_009828
RefSeq (білок)
NP_001228
NP_033958
Локус (UCSC) Хр. 4: 121.82 – 121.82 Mb Хр. 3: 36.56 – 36.57 Mb
PubMed search [1] [2]
Вікідані
Див./Ред. для людейДив./Ред. для мишей

CCNA2 (англ. Cyclin A2) – білок, який кодується однойменним геном, розташованим у людей на короткому плечі 4-ї хромосоми. [3] Довжина поліпептидного ланцюга білка становить 432 амінокислот, а молекулярна маса — 48 551[4].

Послідовність амінокислот
1020304050
MLGNSAPGPATREAGSALLALQQTALQEDQENINPEKAAPVQQPRTRAAL
AVLKSGNPRGLAQQQRPKTRRVAPLKDLPVNDEHVTVPPWKANSKQPAFT
IHVDEAEKEAQKKPAESQKIEREDALAFNSAISLPGPRKPLVPLDYPMDG
SFESPHTMDMSIILEDEKPVSVNEVPDYHEDIHTYLREMEVKCKPKVGYM
KKQPDITNSMRAILVDWLVEVGEEYKLQNETLHLAVNYIDRFLSSMSVLR
GKLQLVGTAAMLLASKFEEIYPPEVAEFVYITDDTYTKKQVLRMEHLVLK
VLTFDLAAPTVNQFLTQYFLHQQPANCKVESLAMFLGELSLIDADPYLKY
LPSVIAGAAFHLALYTVTGQSWPESLIRKTGYTLESLKPCLMDLHQTYLK
APQHAQQSIREKYKNSKYHGVSLLNPPETLNL

Кодований геном білок за функцією належить до фосфопротеїнів. Задіяний у таких біологічних процесах як взаємодія хазяїн-вірус, клітинний цикл, поділ клітини, мітоз, поліморфізм, ацетиляція. Локалізований у цитоплазмі, ядрі.

Література[ред. | ред. код]

  • Wang J., Chenivesse X., Henglein B., Brechot C. (1990). Hepatitis B virus integration in a cyclin A gene in a hepatocellular carcinoma.. Nature 343: 555 — 557.  PubMed DOI:10.1038/343555a0
  • Henglein B., Chenivesse X., Wang D., Eick D., Brechot C. (1994). Structure and cell cycle-regulated transcription of the human cyclin A gene.. Proc. Natl. Acad. Sci. U.S.A. 91: 5490 — 5494.  PubMed DOI:10.1073/pnas.91.12.5490
  • The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).. Genome Res. 14: 2121 — 2127. 2004.  PubMed DOI:10.1101/gr.2596504
  • Tsang W.Y., Wang L., Chen Z., Sanchez I., Dynlacht B.D. (2007). SCAPER, a novel cyclin A-interacting protein that regulates cell cycle progression.. J. Cell Biol. 178: 621 — 633.  PubMed DOI:10.1083/jcb.200701166
  • Russo A.A., Jeffrey P.D., Patten A.K., Massague J., Pavletich N.P. (1996). Crystal structure of the p27Kip1 cyclin-dependent-kinase inhibitor bound to the cyclin A-Cdk2 complex.. Nature 382: 325 — 331.  PubMed DOI:10.1038/382325a0
  • Russo A.A., Jeffrey P.D., Pavletich N.P. (1996). Structural basis of cyclin-dependent kinase activation by phosphorylation.. Nat. Struct. Biol. 3: 696 — 700.  PubMed DOI:10.1038/nsb0896-696

Примітки[ред. | ред. код]

  1. Human PubMed Reference:. 
  2. Mouse PubMed Reference:. 
  3. HUGO Gene Nomenclature Commitee, HGNC:1578 (англ.). Процитовано 30 серпня 2017. 
  4. UniProt, P20248 (англ.). Процитовано 30 серпня 2017. 

Див. також[ред. | ред. код]