ACTN2

Матеріал з Вікіпедії — вільної енциклопедії.
Перейти до навігації Перейти до пошуку
ACTN2
Protein ACTN2 PDB 1h8b.png
Наявні структури
PDBПошук ортологів: PDBe RCSB
Ідентифікатори
Символи ACTN2, CMD1AA, CMH23, actinin alpha 2, MYOCOZ, MPD6
Зовнішні ІД OMIM: 102573 MGI: 109192 HomoloGene: 31016 GeneCards: ACTN2
Пов'язані генетичні захворювання
періодонтит, dilated cardiomyopathy 1AA[1]
Шаблон експресії
PBB GE ACTN2 203863 at fs.png

PBB GE ACTN2 203861 s at fs.png

PBB GE ACTN2 203862 s at fs.png
Більше даних
Ортологи
Види Людина Миша
Entrez
Ensembl
UniProt
RefSeq (мРНК)
NM_001103
NM_001278343
NM_001278344
NM_033268
RefSeq (білок)
NP_001094
NP_001265272
NP_001265273
NP_150371
Локус (UCSC) Хр. 1: 236.66 – 236.76 Mb Хр. 13: 12.27 – 12.34 Mb
PubMed search [2] [3]
Вікідані
Див./Ред. для людейДив./Ред. для мишей

ACTN2 (англ. Actinin alpha 2) – білок, який кодується однойменним геном, розташованим у людей на короткому плечі 1-ї хромосоми. [4] Довжина поліпептидного ланцюга білка становить 894 амінокислот, а молекулярна маса — 103 854[5].

Послідовність амінокислот
1020304050
MNQIEPGVQYNYVYDEDEYMIQEEEWDRDLLLDPAWEKQQRKTFTAWCNS
HLRKAGTQIENIEEDFRNGLKLMLLLEVISGERLPKPDRGKMRFHKIANV
NKALDYIASKGVKLVSIGAEEIVDGNVKMTLGMIWTIILRFAIQDISVEE
TSAKEGLLLWCQRKTAPYRNVNIQNFHTSWKDGLGLCALIHRHRPDLIDY
SKLNKDDPIGNINLAMEIAEKHLDIPKMLDAEDIVNTPKPDERAIMTYVS
CFYHAFAGAEQAETAANRICKVLAVNQENERLMEEYERLASELLEWIRRT
IPWLENRTPEKTMQAMQKKLEDFRDYRRKHKPPKVQEKCQLEINFNTLQT
KLRISNRPAFMPSEGKMVSDIAGAWQRLEQAEKGYEEWLLNEIRRLERLE
HLAEKFRQKASTHETWAYGKEQILLQKDYESASLTEVRALLRKHEAFESD
LAAHQDRVEQIAAIAQELNELDYHDAVNVNDRCQKICDQWDRLGTLTQKR
REALERMEKLLETIDQLHLEFAKRAAPFNNWMEGAMEDLQDMFIVHSIEE
IQSLITAHEQFKATLPEADGERQSIMAIQNEVEKVIQSYNIRISSSNPYS
TVTMDELRTKWDKVKQLVPIRDQSLQEELARQHANERLRRQFAAQANAIG
PWIQNKMEEIARSSIQITGALEDQMNQLKQYEHNIINYKNNIDKLEGDHQ
LIQEALVFDNKHTNYTMEHIRVGWELLLTTIARTINEVETQILTRDAKGI
TQEQMNEFRASFNHFDRRKNGLMDHEDFRACLISMGYDLGEAEFARIMTL
VDPNGQGTVTFQSFIDFMTRETADTDTAEQVIASFRILASDKPYILAEEL
RRELPPDQAQYCIKRMPAYSGPGSVPGALDYAAFSSALYGESDL

Білок має сайт для зв'язування з молекулою актину, іонами металів, іоном кальцію. Локалізований у цитоплазмі.

Література[ред. | ред. код]

  • The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).. Genome Res. 14: 2121 — 2127. 2004.  PubMed DOI:10.1101/gr.2596504
  • Frey N., Richardson J.A., Olson E.N. (2000). Calsarcins, a novel family of sarcomeric calcineurin-binding proteins.. Proc. Natl. Acad. Sci. U.S.A. 97: 14632 — 14637.  PubMed DOI:10.1073/pnas.260501097
  • Frey N., Olson E.N. (2002). Calsarcin-3, a novel skeletal muscle-specific member of the calsarcin family, interacts with multiple Z-disc proteins.. J. Biol. Chem. 277: 13998 — 14004.  PubMed DOI:10.1074/jbc.M200712200
  • Djinovic-Carugo K., Young P., Gautel M., Saraste M. (1999). Structure of the alpha-actinin rod: molecular basis for cross-linking of actin filaments.. Cell 98: 537 — 546.  PubMed DOI:10.1016/S0092-8674(00)81981-9
  • Ylanne J., Scheffzek K., Young P., Saraste M. (2001). Crystal structure of the alpha-actinin rod reveals an extensive torsional twist.. Structure 9: 597 — 604.  PubMed DOI:10.1016/S0969-2126(01)00619-0
  • Bagnall R.D., Molloy L.K., Kalman J.M., Semsarian C. (2014). Exome sequencing identifies a mutation in the ACTN2 gene in a family with idiopathic ventricular fibrillation, left ventricular noncompaction, and sudden death.. BMC Med. Genet. 15: 99 — 99.  PubMed DOI:10.1186/s12881-014-0099-0

Примітки[ред. | ред. код]

Див. також[ред. | ред. код]