ACTN3

Матеріал з Вікіпедії — вільної енциклопедії.
Перейти до навігації Перейти до пошуку
ACTN3
Ідентифікатори
Символи Alpha-actinin skeletal muscle isoform 3alpha-actinin skeletal muscleACTN3alpha-actinin-3actininalpha 3F-actin cross-linking protein
Зовнішні ІД GeneCards: [1]
Ортологи
Види Людина Миша
Entrez
Ensembl
UniProt
RefSeq (мРНК)
н/д
н/д
RefSeq (білок)
н/д
н/д
Локус (UCSC) н/д н/д
PubMed search н/д н/д
Вікідані
Див./Ред. для людей

ACTN3 (англ. Actinin alpha 3 (gene/pseudogene)) – білок, який кодується однойменним геном, розташованим у людей на короткому плечі 11-ї хромосоми.[1] Довжина поліпептидного ланцюга білка становить 901 амінокислот, а молекулярна маса — 103 241[2].

Послідовність амінокислот
1020304050
MMMVMQPEGLGAGEGRFAGGGGGGEYMEQEEDWDRDLLLDPAWEKQQRKT
FTAWCNSHLRKAGTQIENIEEDFRNGLKLMLLLEVISGERLPRPDKGKMR
FHKIANVNKALDFIASKGVKLVSIGAEEIVDGNLKMTLGMIWTIILRFAI
QDISVEETSAKEGLLLWCQRKTAPYRNVNVQNFHTSWKDGLALCALIHRH
RPDLIDYAKLRKDDPIGNLNTAFEVAEKYLDIPKMLDAEDIVNTPKPDEK
AIMTYVSCFYHAFAGAEQAETAANRICKVLAVNQENEKLMEEYEKLASEL
LEWIRRTVPWLENRVGEPSMSAMQRKLEDFRDYRRLHKPPRIQEKCQLEI
NFNTLQTKLRLSHRPAFMPSEGKLVSDIANAWRGLEQVEKGYEDWLLSEI
RRLQRLQHLAEKFRQKASLHEAWTRGKEEMLSQRDYDSALLQEVRALLRR
HEAFESDLAAHQDRVEHIAALAQELNELDYHEAASVNSRCQAICDQWDNL
GTLTQKRRDALERMEKLLETIDRLQLEFARRAAPFNNWLDGAVEDLQDVW
LVHSVEETQSLLTAHDQFKATLPEADRERGAIMGIQGEIQKICQTYGLRP
CSTNPYITLSPQDINTKWDMVRKLVPSCDQTLQEELARQQVNERLRRQFA
AQANAIGPWIQAKVEEVGRLAAGLAGSLEEQMAGLRQQEQNIINYKTNID
RLEGDHQLLQESLVFDNKHTVYSMEHIRVGWEQLLTSIARTINEVENQVL
TRDAKGLSQEQLNEFRASFNHFDRKQNGMMEPDDFRACLISMGYDLGEVE
FARIMTMVDPNAAGVVTFQAFIDFMTRETAETDTTEQVVASFKILAGDKN
YITPEELRRELPAKQAEYCIRRMVPYKGSGAPAGALDYVAFSSALYGESD
L

Задіяний у такому біологічному процесі, як ацетилювання. Білок має сайт для зв'язування з молекулою актину, іонами металів, іоном кальцію.

Література[ред. | ред. код]

  • The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).. Genome Res. 14: 2121 — 2127. 2004.  PubMed DOI:10.1101/gr.2596504
  • Franzot G., Sjoblom B., Gautel M., Djinovic Carugo K. (2005). The crystal structure of the actin binding domain from alpha-actinin in its closed conformation: structural insight into phospholipid regulation of alpha-actinin.. J. Mol. Biol. 348: 151 — 165.  PubMed DOI:10.1016/j.jmb.2005.01.002

Примітки[ред. | ред. код]

  1. HUGO Gene Nomenclature Commitee, HGNC:165 (англ.). Процитовано 8 вересня 2017. 
  2. UniProt, Q08043 (англ.). Процитовано 8 вересня 2017. 

Див. також[ред. | ред. код]