ADGRE5

Матеріал з Вікіпедії — вільної енциклопедії.
Перейти до навігації Перейти до пошуку
ADGRE5
Protein CD97 PDB 2bo2.png
Ідентифікатори
Символи ADGRE5, TM7LN1, CD97, adhesion G protein-coupled receptor E5
Зовнішні ІД OMIM: 601211 MGI: 1347095 HomoloGene: 8050 GeneCards: ADGRE5
Шаблон експресії
PBB GE CD97 202910 s at fs.png
Більше даних
Ортологи
Види Людина Миша
Entrez
Ensembl
UniProt
RefSeq (мРНК)
NM_001025160
NM_001784
NM_078481
NM_001163029
NM_001163030
NM_001163031
NM_011925
RefSeq (білок)
NP_001020331
NP_001775
NP_510966
NP_001156501
NP_001156502
NP_001156503
NP_036055
Локус (UCSC) Хр. 19: 14.38 – 14.41 Mb Хр. 8: 83.72 – 83.74 Mb
PubMed search [1] [2]
Вікідані
Див./Ред. для людейДив./Ред. для мишей

ADGRE5 (англ. Adhesion G protein-coupled receptor E5) – білок, який кодується однойменним геном, розташованим у людей на короткому плечі 19-ї хромосоми.[3] Довжина поліпептидного ланцюга білка становить 835 амінокислот, а молекулярна маса — 91 869[4].

Послідовність амінокислот
1020304050
MGGRVFLAFCVWLTLPGAETQDSRGCARWCPQNSSCVNATACRCNPGFSS
FSEIITTPTETCDDINECATPSKVSCGKFSDCWNTEGSYDCVCSPGYEPV
SGAKTFKNESENTCQDVDECQQNPRLCKSYGTCVNTLGSYTCQCLPGFKF
IPEDPKVCTDVNECTSGQNPCHSSTHCLNNVGSYQCRCRPGWQPIPGSPN
GPNNTVCEDVDECSSGQHQCDSSTVCFNTVGSYSCRCRPGWKPRHGIPNN
QKDTVCEDMTFSTWTPPPGVHSQTLSRFFDKVQDLGRDSKTSSAEVTIQN
VIKLVDELMEAPGDVEALAPPVRHLIATQLLSNLEDIMRILAKSLPKGPF
TYISPSNTELTLMIQERGDKNVTMGQSSARMKLNWAVAAGAEDPGPAVAG
ILSIQNMTTLLANASLNLHSKKQAELEEIYESSIRGVQLRRLSAVNSIFL
SHNNTKELNSPILFAFSHLESSDGEAGRDPPAKDVMPGPRQELLCAFWKS
DSDRGGHWATEGCQVLGSKNGSTTCQCSHLSSFAILMAHYDVEDWKLTLI
TRVGLALSLFCLLLCILTFLLVRPIQGSRTTIHLHLCICLFVGSTIFLAG
IENEGGQVGLRCRLVAGLLHYCFLAAFCWMSLEGLELYFLVVRVFQGQGL
STRWLCLIGYGVPLLIVGVSAAIYSKGYGRPRYCWLDFEQGFLWSFLGPV
TFIILCNAVIFVTTVWKLTQKFSEINPDMKKLKKARALTITAIAQLFLLG
CTWVFGLFIFDDRSLVLTYVFTILNCLQGAFLYLLHCLLNKKVREEYRKW
ACLVAGGSKYSEFTSTTSGTGHNQTRALRASESGI

Кодований геном білок за функціями належить до рецепторів, g-білокспряжених рецепторів, білків внутрішньоклітинного сигналінгу, фосфопротеїнів. Задіяний у таких біологічних процесах, як клітинна адгезія, альтернативний сплайсинг. Білок має сайт для зв'язування з іоном кальцію. Локалізований у клітинній мембрані, мембрані. Також секретований назовні.

Література[ред. | ред. код]

  • Hamann J., Hartmann E., van Lier R.A.W. (1996). Structure of the human CD97 gene: exon shuffling has generated a new type of seven-span transmembrane molecule related to the secretin receptor superfamily.. Genomics 32: 144 — 147.  PubMed DOI:10.1006/geno.1996.0092
  • The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).. Genome Res. 14: 2121 — 2127. 2004.  PubMed DOI:10.1101/gr.2596504

Примітки[ред. | ред. код]

  1. Human PubMed Reference:. 
  2. Mouse PubMed Reference:. 
  3. HUGO Gene Nomenclature Commitee, HGNC:1711 (англ.). Процитовано 12 вересня 2017. 
  4. UniProt, P48960 (англ.). Процитовано 12 вересня 2017. 

Див. також[ред. | ред. код]