ADORA1

Матеріал з Вікіпедії — вільної енциклопедії.
Перейти до навігації Перейти до пошуку
ADORA1
Ідентифікатори
Символи ADORA1, RDC7, adenosine A1 receptor
Зовнішні ІД OMIM: 102775 MGI: 99401 HomoloGene: 20165 GeneCards: ADORA1
Реагує на сполуку
Аденозин, BAY 60-6583, regadenoson, CCPA, cgs-21680, cyclopentyladenosine, 8-cyclopentyltheophylline, кофеїн, CGS 15943, 8-cyclopentyl-1,3-dipropylxanthine, isobutylmethylxanthine, istradefylline, preladenant, rolofylline, sch-442416, sch-58261, Теофілін, ZM-241385[1]
Шаблон експресії
PBB GE ADORA1 205481 at fs.png

PBB GE ADORA1 216220 s at fs.png
Більше даних
Ортологи
Види Людина Миша
Entrez
Ensembl
UniProt
RefSeq (мРНК)
NM_000674
NM_001048230
NM_001365065
NM_001365066
RefSeq (білок)
NP_000665
NP_001041695
NP_001351994
NP_001351995
NP_001008533
NP_001034599
NP_001269874
NP_001278857
NP_001278859
Локус (UCSC) Хр. 1: 203.09 – 203.17 Mb Хр. 1: 134.2 – 134.24 Mb
PubMed search [2] [3]
Вікідані
Див./Ред. для людейДив./Ред. для мишей

ADORA1 (англ. Adenosine A1 receptor) – білок, який кодується однойменним геном, розташованим у людей на короткому плечі 1-ї хромосоми. [4] Довжина поліпептидного ланцюга білка становить 326 амінокислот, а молекулярна маса — 36 512[5].

Послідовність амінокислот
1020304050
MPPSISAFQAAYIGIEVLIALVSVPGNVLVIWAVKVNQALRDATFCFIVS
LAVADVAVGALVIPLAILINIGPQTYFHTCLMVACPVLILTQSSILALLA
IAVDRYLRVKIPLRYKMVVTPRRAAVAIAGCWILSFVVGLTPMFGWNNLS
AVERAWAANGSMGEPVIKCEFEKVISMEYMVYFNFFVWVLPPLLLMVLIY
LEVFYLIRKQLNKKVSASSGDPQKYYGKELKIAKSLALILFLFALSWLPL
HILNCITLFCPSCHKPSILTYIAIFLTHGNSAMNPIVYAFRIQKFRVTFL
KIWNDHFRCQPAPPIDEDLPEERPDD

Кодований геном білок за функціями належить до рецепторів, g-білокспряжених рецепторів, білків внутрішньоклітинного сигналінгу. Локалізований у клітинній мембрані, мембрані.

Література[ред. | ред. код]

  • Townsend-Nicholson A., Shine J. (1992). Molecular cloning and characterisation of a human brain A1 adenosine receptor cDNA.. Brain Res. Mol. Brain Res. 16: 365 — 370.  PubMed DOI:10.1016/0169-328X(92)90248-A
  • The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).. Genome Res. 14: 2121 — 2127. 2004.  PubMed DOI:10.1101/gr.2596504
  • Ren H., Stiles G.L. (1994). Characterization of the human A1 adenosine receptor gene. Evidence for alternative splicing.. J. Biol. Chem. 269: 3104 — 3110.  PubMed

Примітки[ред. | ред. код]

Див. також[ред. | ред. код]