AHR

Матеріал з Вікіпедії — вільної енциклопедії.
Перейти до навігації Перейти до пошуку
AHR
Ідентифікатори
Символи ah receptoraromatic hydrocarbon receptorAH-receptorAHRbHLHe76class E basic helix-loop-helix protein 76aryl hydrocarbon receptor
Зовнішні ІД GeneCards: [1]
Ортологи
Види Людина Миша
Entrez
Ensembl
UniProt
RefSeq (мРНК)
н/д
н/д
RefSeq (білок)
н/д
н/д
Локус (UCSC) н/д н/д
PubMed search н/д н/д
Вікідані
Див./Ред. для людей

AHR (англ. Aryl hydrocarbon receptor) – білок, який кодується однойменним геном, розташованим у людей на короткому плечі 7-ї хромосоми.[1] Довжина поліпептидного ланцюга білка становить 848 амінокислот, а молекулярна маса — 96 147[2].

Послідовність амінокислот
1020304050
MNSSSANITYASRKRRKPVQKTVKPIPAEGIKSNPSKRHRDRLNTELDRL
ASLLPFPQDVINKLDKLSVLRLSVSYLRAKSFFDVALKSSPTERNGGQDN
CRAANFREGLNLQEGEFLLQALNGFVLVVTTDALVFYASSTIQDYLGFQQ
SDVIHQSVYELIHTEDRAEFQRQLHWALNPSQCTESGQGIEEATGLPQTV
VCYNPDQIPPENSPLMERCFICRLRCLLDNSSGFLAMNFQGKLKYLHGQK
KKGKDGSILPPQLALFAIATPLQPPSILEIRTKNFIFRTKHKLDFTPIGC
DAKGRIVLGYTEAELCTRGSGYQFIHAADMLYCAESHIRMIKTGESGMIV
FRLLTKNNRWTWVQSNARLLYKNGRPDYIIVTQRPLTDEEGTEHLRKRNT
KLPFMFTTGEAVLYEATNPFPAIMDPLPLRTKNGTSGKDSATTSTLSKDS
LNPSSLLAAMMQQDESIYLYPASSTSSTAPFENNFFNESMNECRNWQDNT
APMGNDTILKHEQIDQPQDVNSFAGGHPGLFQDSKNSDLYSIMKNLGIDF
EDIRHMQNEKFFRNDFSGEVDFRDIDLTDEILTYVQDSLSKSPFIPSDYQ
QQQSLALNSSCMVQEHLHLEQQQQHHQKQVVVEPQQQLCQKMKHMQVNGM
FENWNSNQFVPFNCPQQDPQQYNVFTDLHGISQEFPYKSEMDSMPYTQNF
ISCNQPVLPQHSKCTELDYPMGSFEPSPYPTTSSLEDFVTCLQLPENQKH
GLNPQSAIITPQTCYAGAVSMYQCQPEPQHTHVGQMQYNPVLPGQQAFLN
KFQNGVLNETYPAELNNINNTQTTTHLQPLHHPSEARPFPDLTSSGFL

Кодований геном білок за функціями належить до репресорів, рецепторів, активаторів. Задіяний у таких біологічних процесах, як транскрипція, регуляція транскрипції, клітинний цикл, біологічні ритми, ацетилювання. Білок має сайт для зв'язування з ДНК. Локалізований у цитоплазмі, ядрі.

Література[ред. | ред. код]

  • Itoh S., Kamataki T. (1993). Human Ah receptor cDNA: analysis for highly conserved sequences.. Nucleic Acids Res. 21: 3578 — 3578.  PubMed DOI:10.1093/nar/21.15.3578
  • The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).. Genome Res. 14: 2121 — 2127. 2004.  PubMed DOI:10.1101/gr.2596504
  • Bennett P., Ramsden D.B., Williams A.C. (1996). Complete structural characterisation of the human aryl hydrocarbon receptor gene.. Clin. Mol. Pathol. 49: M12 — M16.  PubMed DOI:10.1136/mp.49.1.M12
  • Nguyen T.A., Hoivik D., Lee J.-E., Safe S. (1999). Interactions of nuclear receptor coactivator/corepressor proteins with the aryl hydrocarbon receptor complex.. Arch. Biochem. Biophys. 367: 250 — 257.  PubMed DOI:10.1006/abbi.1999.1282
  • Puga A., Xia Y., Elferink C. (2002). Role of the aryl hydrocarbon receptor in cell cycle regulation.. Chem. Biol. Interact. 141: 117 — 130.  PubMed DOI:10.1016/S0009-2797(02)00069-8
  • Antenos M., Casper R.F., Brown T.J. (2002). Interaction with Nedd8, a ubiquitin-like protein, enhances the transcriptional activity of the aryl hydrocarbon receptor.. J. Biol. Chem. 277: 44028 — 44034.  PubMed DOI:10.1074/jbc.M202413200

Примітки[ред. | ред. код]

  1. HUGO Gene Nomenclature Commitee, HGNC:348 (англ.). Процитовано 7 вересня 2017. 
  2. UniProt, P35869 (англ.). Процитовано 7 вересня 2017. 

Див. також[ред. | ред. код]