ANK2

Матеріал з Вікіпедії — вільної енциклопедії.
Перейти до навігації Перейти до пошуку
ANK2
Наявні структури
PDBПошук для людей: PDBe RCSB
Ідентифікатори
Символи ANK2, ANK-2, LQT4, brank-2, ankyrin 2, neuronal, ankyrin 2
Зовнішні ІД OMIM: 106410 HomoloGene: 81655 GeneCards: ANK2
Пов'язані генетичні захворювання
рак простати[1]
Ортологи
Види Людина Миша
Entrez
Ensembl
UniProt
RefSeq (мРНК)
NM_001127493
NM_001148
NM_020977
XM_008761478
XM_008775288
RefSeq (білок)
н/д
Локус (UCSC) н/д н/д
PubMed search [2] [3]
Вікідані
Див./Ред. для людейДив./Ред. для мишей

ANK2 (англ. Ankyrin 2) – білок, який кодується однойменним геном, розташованим у людей на 4-ї хромосомі.[4] Довжина поліпептидного ланцюга білка становить 3 957 амінокислот, а молекулярна маса — 433 715[5].

Послідовність амінокислот
1020304050
MMNEDAAQKSDSGEKFNGSSQRRKRPKKSDSNASFLRAARAGNLDKVVEY
LKGGIDINTCNQNGLNALHLAAKEGHVGLVQELLGRGSSVDSATKKGNTA
LHIASLAGQAEVVKVLVKEGANINAQSQNGFTPLYMAAQENHIDVVKYLL
ENGANQSTATEDGFTPLAVALQQGHNQAVAILLENDTKGKVRLPALHIAA
RKDDTKSAALLLQNDHNADVQSKMMVNRTTESGFTPLHIAAHYGNVNVAT
LLLNRGAAVDFTARNGITPLHVASKRGNTNMVKLLLDRGGQIDAKTRDGL
TPLHCAARSGHDQVVELLLERGAPLLARTKNGLSPLHMAAQGDHVECVKH
LLQHKAPVDDVTLDYLTALHVAAHCGHYRVTKLLLDKRANPNARALNGFT
PLHIACKKNRIKVMELLVKYGASIQAITESGLTPIHVAAFMGHLNIVLLL
LQNGASPDVTNIRGETALHMAARAGQVEVVRCLLRNGALVDARAREEQTP
LHIASRLGKTEIVQLLLQHMAHPDAATTNGYTPLHISAREGQVDVASVLL
EAGAAHSLATKKGFTPLHVAAKYGSLDVAKLLLQRRAAADSAGKNGLTPL
HVAAHYDNQKVALLLLEKGASPHATAKNGYTPLHIAAKKNQMQIASTLLN
YGAETNIVTKQGVTPLHLASQEGHTDMVTLLLDKGANIHMSTKSGLTSLH
LAAQEDKVNVADILTKHGADQDAHTKLGYTPLIVACHYGNVKMVNFLLKQ
GANVNAKTKNGYTPLHQAAQQGHTHIINVLLQHGAKPNATTANGNTALAI
AKRLGYISVVDTLKVVTEEVTTTTTTITEKHKLNVPETMTEVLDVSDEEG
DDTMTGDGGEYLRPEDLKELGDDSLPSSQFLDGMNYLRYSLEGGRSDSLR
SFSSDRSHTLSHASYLRDSAVMDDSVVIPSHQVSTLAKEAERNSYRLSWG
TENLDNVALSSSPIHSGFLVSFMVDARGGAMRGCRHNGLRIIIPPRKCTA
PTRVTCRLVKRHRLATMPPMVEGEGLASRLIEVGPSGAQFLGKLHLPTAP
PPLNEGESLVSRILQLGPPGTKFLGPVIVEIPHFAALRGKERELVVLRSE
NGDSWKEHFCDYTEDELNEILNGMDEVLDSPEDLEKKRICRIITRDFPQY
FAVVSRIKQDSNLIGPEGGVLSSTVVPQVQAVFPEGALTKRIRVGLQAQP
MHSELVKKILGNKATFSPIVTLEPRRRKFHKPITMTIPVPKASSDVMLNG
FGGDAPTLRLLCSITGGTTPAQWEDITGTTPLTFVNECVSFTTNVSARFW
LIDCRQIQESVTFASQVYREIICVPYMAKFVVFAKSHDPIEARLRCFCMT
DDKVDKTLEQQENFAEVARSRDVEVLEGKPIYVDCFGNLVPLTKSGQHHI
FSFFAFKENRLPLFVKVRDTTQEPCGRLSFMKEPKSTRGLVHQAICNLNI
TLPIYTKESESDQEQEEEIDMTSEKNDETESTETSVLKSHLVNEVPVLAS
PDLLSEVSEMKQDLIKMTAILTTDVSDKAGSIKVKELVKAAEEEPGEPFE
IVERVKEDLEKVNEILRSGTCTRDESSVQSSRSERGLVEEEWVIVSDEEI
EEARQKAPLEITEYPCVEVRIDKEIKGKVEKDSTGLVNYLTDDLNTCVPL
PKEQLQTVQDKAGKKCEALAVGRSSEKEGKDIPPDETQSTQKQHKPSLGI
KKPVRRKLKEKQKQKEEGLQASAEKAELKKGSSEESLGEDPGLAPEPLPT
VKATSPLIEETPIGSIKDKVKALQKRVEDEQKGRSKLPIRVKGKEDVPKK
TTHRPHPAASPSLKSERHAPGSPSPKTERHSTLSSSAKTERHPPVSPSSK
TEKHSPVSPSAKTERHSPASSSSKTEKHSPVSPSTKTERHSPVSSTKTER
HPPVSPSGKTDKRPPVSPSGRTEKHPPVSPGRTEKRLPVSPSGRTDKHQP
VSTAGKTEKHLPVSPSGKTEKQPPVSPTSKTERIEETMSVRELMKAFQSG
QDPSKHKTGLFEHKSAKQKQPQEKGKVRVEKEKGPILTQREAQKTENQTI
KRGQRLPVTGTAESKRGVRVSSIGVKKEDAAGGKEKVLSHKIPEPVQSVP
EEESHRESEVPKEKMADEQGDMDLQISPDRKTSTDFSEVIKQELEDNDKY
QQFRLSEETEKAQLHLDQVLTSPFNTTFPLDYMKDEFLPALSLQSGALDG
SSESLKNEGVAGSPCGSLMEGTPQISSEESYKHEGLAETPETSPESLSFS
PKKSEEQTGETKESTKTETTTEIRSEKEHPTTKDITGGSEERGATVTEDS
ETSTESFQKEATLGSPKDTSPKRQDDCTGSCSVALAKETPTGLTEEAACD
EGQRTFGSSAHKTQTDSEVQESTATSDETKALPLPEASVKTDTGTESKPQ
GVIRSPQGLELALPSRDSEVLSAVADDSLAVSHKDSLEASPVLEDNSSHK
TPDSLEPSPLKESPCRDSLESSPVEPKMKAGIFPSHFPLPAAVAKTELLT
EVASVRSRLLRDPDGSAEDDSLEQTSLMESSGKSPLSPDTPSSEEVSYEV
TPKTTDVSTPKPAVIHECAEEDDSENGEKKRFTPEEEMFKMVTKIKMFDE
LEQEAKQKRDYKKEPKQEESSSSSDPDADCSVDVDEPKHTGSGEDESGVP
VLVTSESRKVSSSSESEPELAQLKKGADSGLLPEPVIRVQPPSPLPSSMD
SNSSPEEVQFQPVVSKQYTFKMNEDTQEEPGKSEEEKDSESHLAEDRHAV
STEAEDRSYDKLNRDTDQPKICDGHGCEAMSPSSSAAPVSSGLQSPTGDD
VDEQPVIYKESLALQGTHEKDTEGEELDVSRAESPQADCPSESFSSSSSL
PHCLVSEGKELDEDISATSSIQKTEVTKTDETFENLPKDCPSQDSSITTQ
TDRFSMDVPVSDLAENDEIYDPQITSPYENVPSQSFFSSEESKTQTDANH
TTSFHSSEVYSVTITSPVEDVVVASSSSGTVLSKESNFEGQDIKMESQQE
STLWEMQSDSVSSSFEPTMSATTTVVGEQISKVIITKTDVDSDSWSEIRE
DDEAFEARVKEEEQKIFGLMVDRQSQGTTPDTTPARTPTEEGTPTSEQNP
FLFQEGKLFEMTRSGAIDMTKRSYADESFHFFQIGQESREETLSEDVKEG
ATGADPLPLETSAESLALSESKETVDDEADLLPDDVSEEVEEIPASDAQL
NSQMGISASTETPTKEAVSVGTKDLPTVQTGDIPPLSGVKQISCPDSSEP
AVQVQLDFSTLTRSVYSDRGDDSPDSSPEEQKSVIEIPTAPMENVPFTES
KSKIPVRTMPTSTPAPPSAEYESSVSEDFLSSVDEENKADEAKPKSKLPV
KVPLQRVEQQLSDLDTSVQKTVAPQGQDMASIAPDNRSKSESDASSLDSK
TKCPVKTRSYTETETESRERAEELELESEEGATRPKILTSRLPVKSRSTT
SSCRGGTSPTKESKEHFFDLYRNSIEFFEEISDEASKLVDRLTQSEREQE
IVSDDESSSALEVSVIENLPPVETEHSVPEDIFDTRPIWDESIETLIERI
PDENGHDHAEDPQDEQERIEERLAYIADHLGFSWTELARELDFTEEQIHQ
IRIENPNSLQDQSHALLKYWLERDGKHATDTNLVECLTKINRMDIVHLME
TNTEPLQERISHSYAEIEQTITLDHSEGFSVLQEELCTAQHKQKEEQAVS
KESETCDHPPIVSEEDISVGYSTFQDGVPKTEGDSSATALFPQTHKEQVQ
QDFSGKMQDLPEESSLEYQQEYFVTTPGTETSETQKAMIVPSSPSKTPEE
VSTPAEEEKLYLQTPTSSERGGSPIIQEPEEPSEHREESSPRKTSLVIVE
SADNQPETCERLDEDAAFEKGDDMPEIPPETVTEEEYIDEHGHTVVKKVT
RKIIRRYVSSEGTEKEEIMVQGMPQEPVNIEEGDGYSKVIKRVVLKSDTE
QSEDNNE

Кодований геном білок за функцією належить до фосфопротеїнів. Задіяний у такому біологічному процесі, як альтернативний сплайсинг. Локалізований у клітинній мембрані, цитоплазмі, цитоскелеті, мембрані, клітинних контактах, синапсах.

Література[ред. | ред. код]

  • Otto E., Kunimoto M., McLaughlin T., Bennett V. (1991). Isolation and characterization of cDNAs encoding human brain ankyrins reveal a family of alternatively spliced genes.. J. Cell Biol. 114: 241 — 253.  PubMed DOI:10.1083/jcb.114.2.241
  • Chan W., Kordeli E., Bennett V. (1993). 440-kD ankyrinB: structure of the major developmentally regulated domain and selective localization in unmyelinated axons.. J. Cell Biol. 123: 1463 — 1473.  PubMed DOI:10.1083/jcb.123.6.1463
  • The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).. Genome Res. 14: 2121 — 2127. 2004.  PubMed DOI:10.1101/gr.2596504
  • Mohler P.J., Yoon W., Bennett V. (2004). Ankyrin-B targets beta2-spectrin to an intracellular compartment in neonatal cardiomyocytes.. J. Biol. Chem. 279: 40185 — 40193.  PubMed DOI:10.1074/jbc.M406018200
  • Kizhatil K., Sandhu N.K., Peachey N.S., Bennett V. (2009). Ankyrin-B is required for coordinated expression of beta-2-spectrin, the Na/K-ATPase and the Na/Ca exchanger in the inner segment of rod photoreceptors.. Exp. Eye Res. 88: 57 — 64.  PubMed DOI:10.1016/j.exer.2008.09.022
  • Wang C., Yu C., Ye F., Wei Z., Zhang M. (2012). Structure of the ZU5-ZU5-UPA-DD tandem of ankyrin-B reveals interaction surfaces necessary for ankyrin function.. Proc. Natl. Acad. Sci. U.S.A. 109: 4822 — 4827.  PubMed DOI:10.1073/pnas.1200613109

Примітки[ред. | ред. код]

Див. також[ред. | ред. код]