AP1G1

Матеріал з Вікіпедії — вільної енциклопедії.
Перейти до навігації Перейти до пошуку
AP1G1
Protein AP1G1 PDB 1gyu.png
Наявні структури
PDBПошук ортологів: PDBe RCSB
Ідентифікатори
Символи AP1G1, ADTG, CLAPG1, adaptor related protein complex 1 gamma 1 subunit, adaptor related protein complex 1 subunit gamma 1
Зовнішні ІД OMIM: 603533 MGI: 101919 HomoloGene: 47995 GeneCards: AP1G1
Шаблон експресії
PBB GE AP1G1 203350 at fs.png
Більше даних
Ортологи
Види Людина Миша
Entrez
Ensembl
UniProt
RefSeq (мРНК)
NM_001128
NM_001030007
NM_001301211
NM_009677
RefSeq (білок)
NP_001025178
NP_001119
NP_001288140
NP_033807
Локус (UCSC) Хр. 16: 71.73 – 71.81 Mb Хр. 8: 109.78 – 109.86 Mb
PubMed search [1] [2]
Вікідані
Див./Ред. для людейДив./Ред. для мишей

AP1G1 (англ. Adaptor related protein complex 1 gamma 1 subunit) – білок, який кодується однойменним геном, розташованим у людей на короткому плечі 16-ї хромосоми.[3] Довжина поліпептидного ланцюга білка становить 822 амінокислот, а молекулярна маса — 91 351[4].

Послідовність амінокислот
1020304050
MPAPIRLRELIRTIRTARTQAEEREMIQKECAAIRSSFREEDNTYRCRNV
AKLLYMHMLGYPAHFGQLECLKLIASQKFTDKRIGYLGAMLLLDERQDVH
LLMTNCIKNDLNHSTQFVQGLALCTLGCMGSSEMCRDLAGEVEKLLKTSN
SYLRKKAALCAVHVIRKVPELMEMFLPATKNLLNEKNHGVLHTSVVLLTE
MCERSPDMLAHFRKLVPQLVRILKNLIMSGYSPEHDVSGISDPFLQVRIL
RLLRILGRNDDDSSEAMNDILAQVATNTETSKNVGNAILYETVLTIMDIK
SESGLRVLAINILGRFLLNNDKNIRYVALTSLLKTVQTDHNAVQRHRSTI
VDCLKDLDVSIKRRAMELSFALVNGNNIRGMMKELLYFLDSCEPEFKADC
ASGIFLAAEKYAPSKRWHIDTIMRVLTTAGSYVRDDAVPNLIQLITNSVE
MHAYTVQRLYKAILGDYSQQPLVQVAAWCIGEYGDLLVSGQCEEEEPIQV
TEDEVLDILESVLISNMSTSVTRGYALTAIMKLSTRFTCTVNRIKKVVSI
YGSSIDVELQQRAVEYNALFKKYDHMRSALLERMPVMEKVTTNGPTEIVQ
TNGETEPAPLETKPPPSGPQPTSQANDLLDLLGGNDITPVIPTAPTSKPS
SAGGELLDLLGDINLTGAPAAAPAPASVPQISQPPFLLDGLSSQPLFNDI
AAGIPSITAYSKNGLKIEFTFERSNTNPSVTVITIQASNSTELDMTDFVF
QAAVPKTFQLQLLSPSSSIVPAFNTGTITQVIKVLNPQKQQLRMRIKLTY
NHKGSAMQDLAEVNNFPPQSWQ

Задіяний у таких біологічних процесах, як транспорт, транспорт білків, альтернативний сплайсинг. Локалізований у мембрані, цитоплазматичних везикулах, апараті гольджі.

Література[ред. | ред. код]

  • Takatsu H., Sakurai M., Shin H.-W., Murakami K., Nakayama K. (1998). Identification and characterization of novel clathrin adaptor-related proteins.. J. Biol. Chem. 273: 24693 — 24700.  PubMed DOI:10.1074/jbc.273.38.24693

Примітки[ред. | ред. код]

  1. Human PubMed Reference:. 
  2. Mouse PubMed Reference:. 
  3. HUGO Gene Nomenclature Commitee, HGNC:555 (англ.). Процитовано 11 вересня 2017. 
  4. UniProt, O43747 (англ.). Процитовано 11 вересня 2017. 

Див. також[ред. | ред. код]