ARF1

Матеріал з Вікіпедії — вільної енциклопедії.
Перейти до навігації Перейти до пошуку
ARF1
Protein ARF1 PDB 1hur.png
Наявні структури
PDBПошук ортологів: PDBe RCSB
Ідентифікатори
Символи ARF1, ADP ribosylation factor 1, PVNH8
Зовнішні ІД OMIM: 103180 MGI: 99431 HomoloGene: 133930 GeneCards: ARF1
Шаблон експресії
PBB GE ARF1 208750 s at fs.png
Більше даних
Ортологи
Види Людина Миша
Entrez
Ensembl
UniProt
RefSeq (мРНК)
NM_001658
NM_001024226
NM_001024227
NM_001024228
NM_001130408
NM_007476
RefSeq (білок)
NP_001019397
NP_001019398
NP_001019399
NP_001649
NP_001123880
NP_031502
Локус (UCSC) Хр. 1: 228.08 – 228.1 Mb Хр. 11: 59.21 – 59.23 Mb
PubMed search [1] [2]
Вікідані
Див./Ред. для людейДив./Ред. для мишей

ARF1 (англ. ADP ribosylation factor 1) – білок, який кодується однойменним геном, розташованим у людей на короткому плечі 1-ї хромосоми. [3] Довжина поліпептидного ланцюга білка становить 181 амінокислот, а молекулярна маса — 20 697[4].

Послідовність амінокислот
1020304050
MGNIFANLFKGLFGKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIG
FNVETVEYKNISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRERV
NEAREELMRMLAEDELRDAVLLVFANKQDLPNAMNAAEITDKLGLHSLRH
RNWYIQATCATSGDGLYEGLDWLSNQLRNQK

Задіяний у таких біологічних процесах як транспорт, транспорт білків, транспорт між ендоплазматичним ретикулумом і апаратом Гольджі, ацетиляція. Білок має сайт для зв'язування з нуклеотидами, ГТФ. Локалізований у клітинній мембрані, цитоплазмі, мембрані, клітинних контактах, апараті гольджі, синапсах, синаптосомах[en].

Література[ред. | ред. код]

  • The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).. Genome Res. 14: 2121 — 2127. 2004.  PubMed DOI:10.1101/gr.2596504
  • Haynes L.P., Sherwood M.W., Dolman N.J., Burgoyne R.D. (2007). Specificity, promiscuity and localization of ARF protein interactions with NCS-1 and phosphatidylinositol-4 kinase-III beta.. Traffic 8: 1080 — 1092.  PubMed DOI:10.1111/j.1600-0854.2007.00594.x
  • Amor J.C., Harrison D.H., Kahn R.A., Ringe D. (1994). Structure of the human ADP-ribosylation factor 1 complexed with GDP.. Nature 372: 704 — 708.  PubMed DOI:10.1038/372704a0
  • Goldberg J. (1999). Structural and functional analysis of the ARF1-ARFGAP complex reveals a role for coatomer in GTP hydrolysis.. Cell 96: 893 — 902.  PubMed DOI:10.1016/S0092-8674(00)80598-X
  • Mossessova E., Corpina R.A., Goldberg J. (2003). Crystal structure of ARF1*Sec7 complexed with brefeldin A and its implications for the guanine nucleotide exchange mechanism.. Mol. Cell 12: 1403 — 1411.  PubMed DOI:10.1016/S1097-2765(03)00475-1
  • Seidel R.D., Amor J.C., Kahn R.A., Prestegard J.H. (2004). Conformational changes in human Arf1 on nucleotide exchange and deletion of membrane-binding elements.. J. Biol. Chem. 279: 48307 — 48318.  PubMed DOI:10.1074/jbc.M402109200

Примітки[ред. | ред. код]

  1. Human PubMed Reference:. 
  2. Mouse PubMed Reference:. 
  3. HUGO Gene Nomenclature Commitee, HGNC:652 (англ.). Процитовано 25 серпня 2017. 
  4. UniProt, P84077 (англ.). Процитовано 25 серпня 2017. 

Див. також[ред. | ред. код]