ARID1A

Матеріал з Вікіпедії — вільної енциклопедії.
Перейти до навігації Перейти до пошуку
ARID1A
Protein ARID1A PDB 1ryu.png
Наявні структури
PDBПошук ортологів: PDBe RCSB
Ідентифікатори
Символи ARID1A, B120, BAF250, BAF250a, BM029, C1orf4, ELD, MRD14, OSA1, P270, SMARCF1, hELD, hOSA1, CSS2, AT-rich interaction domain 1A
Зовнішні ІД MGI: 1935147 HomoloGene: 21216 GeneCards: ARID1A
Шаблон експресії
PBB GE ARID1A 210649 s at fs.png

PBB GE ARID1A 212152 x at fs.png

PBB GE ARID1A 218917 s at fs.png
Більше даних
Ортологи
Види Людина Миша
Entrez
Ensembl
UniProt
RefSeq (мРНК)
NM_139135
NM_006015
NM_018450
NM_001080819
NM_001363070
RefSeq (білок)
NP_006006
NP_624361
NP_001074288
NP_001349999
Локус (UCSC) Хр. 1: 26.69 – 26.78 Mb Хр. 4: 133.68 – 133.76 Mb
PubMed search [1] [2]
Вікідані
Див./Ред. для людейДив./Ред. для мишей

ARID1A (англ. AT-rich interaction domain 1A) – білок, який кодується однойменним геном, розташованим у людей на короткому плечі 1-ї хромосоми. [3] Довжина поліпептидного ланцюга білка становить 2 285 амінокислот, а молекулярна маса — 242 045[4].

Послідовність амінокислот
1020304050
MAAQVAPAAASSLGNPPPPPPSELKKAEQQQREEAGGEAAAAAAAERGEM
KAAAGQESEGPAVGPPQPLGKELQDGAESNGGGGGGGAGSGGGPGAEPDL
KNSNGNAGPRPALNNNLTEPPGGGGGGSSDGVGAPPHSAAAALPPPAYGF
GQPYGRSPSAVAAAAAAVFHQQHGGQQSPGLAALQSGGGGGLEPYAGPQQ
NSHDHGFPNHQYNSYYPNRSAYPPPAPAYALSSPRGGTPGSGAAAAAGSK
PPPSSSASASSSSSSFAQQRFGAMGGGGPSAAGGGTPQPTATPTLNQLLT
SPSSARGYQGYPGGDYSGGPQDGGAGKGPADMASQCWGAAAAAAAAAAAS
GGAQQRSHHAPMSPGSSGGGGQPLARTPQPSSPMDQMGKMRPQPYGGTNP
YSQQQGPPSGPQQGHGYPGQPYGSQTPQRYPMTMQGRAQSAMGGLSYTQQ
IPPYGQQGPSGYGQQGQTPYYNQQSPHPQQQQPPYSQQPPSQTPHAQPSY
QQQPQSQPPQLQSSQPPYSQQPSQPPHQQSPAPYPSQQSTTQQHPQSQPP
YSQPQAQSPYQQQQPQQPAPSTLSQQAAYPQPQSQQSQQTAYSQQRFPPP
QELSQDSFGSQASSAPSMTSSKGGQEDMNLSLQSRPSSLPDLSGSIDDLP
MGTEGALSPGVSTSGISSSQGEQSNPAQSPFSPHTSPHLPGIRGPSPSPV
GSPASVAQSRSGPLSPAAVPGNQMPPRPPSGQSDSIMHPSMNQSSIAQDR
GYMQRNPQMPQYSSPQPGSALSPRQPSGGQIHTGMGSYQQNSMGSYGPQG
GQYGPQGGYPRQPNYNALPNANYPSAGMAGGINPMGAGGQMHGQPGIPPY
GTLPPGRMSHASMGNRPYGPNMANMPPQVGSGMCPPPGGMNRKTQETAVA
MHVAANSIQNRPPGYPNMNQGGMMGTGPPYGQGINSMAGMINPQGPPYSM
GGTMANNSAGMAASPEMMGLGDVKLTPATKMNNKADGTPKTESKSKKSSS
STTTNEKITKLYELGGEPERKMWVDRYLAFTEEKAMGMTNLPAVGRKPLD
LYRLYVSVKEIGGLTQVNKNKKWRELATNLNVGTSSSAASSLKKQYIQCL
YAFECKIERGEDPPPDIFAAADSKKSQPKIQPPSPAGSGSMQGPQTPQST
SSSMAEGGDLKPPTPASTPHSQIPPLPGMSRSNSVGIQDAFNDGSDSTFQ
KRNSMTPNPGYQPSMNTSDMMGRMSYEPNKDPYGSMRKAPGSDPFMSSGQ
GPNGGMGDPYSRAAGPGLGNVAMGPRQHYPYGGPYDRVRTEPGIGPEGNM
STGAPQPNLMPSNPDSGMYSPSRYPPQQQQQQQQRHDSYGNQFSTQGTPS
GSPFPSQQTTMYQQQQQNYKRPMDGTYGPPAKRHEGEMYSVPYSTGQGQP
QQQQLPPAQPQPASQQQAAQPSPQQDVYNQYGNAYPATATAATERRPAGG
PQNQFPFQFGRDRVSAPPGTNAQQNMPPQMMGGPIQASAEVAQQGTMWQG
RNDMTYNYANRQSTGSAPQGPAYHGVNRTDEMLHTDQRANHEGSWPSHGT
RQPPYGPSAPVPPMTRPPPSNYQPPPSMQNHIPQVSSPAPLPRPMENRTS
PSKSPFLHSGMKMQKAGPPVPASHIAPAPVQPPMIRRDITFPPGSVEATQ
PVLKQRRRLTMKDIGTPEAWRVMMSLKSGLLAESTWALDTINILLYDDNS
IMTFNLSQLPGLLELLVEYFRRCLIEIFGILKEYEVGDPGQRTLLDPGRF
SKVSSPAPMEGGEEEEELLGPKLEEEEEEEVVENDEEIAFSGKDKPASEN
SEEKLISKFDKLPVKIVQKNDPFVVDCSDKLGRVQEFDSGLLHWRIGGGD
TTEHIQTHFESKTELLPSRPHAPCPPAPRKHVTTAEGTPGTTDQEGPPPD
GPPEKRITATMDDMLSTRSSTLTEDGAKSSEAIKESSKFPFGISPAQSHR
NIKILEDEPHSKDETPLCTLLDWQDSLAKRCVCVSNTIRSLSFVPGNDFE
MSKHPGLLLILGKLILLHHKHPERKQAPLTYEKEEEQDQGVSCNKVEWWW
DCLEMLRENTLVTLANISGQLDLSPYPESICLPVLDGLLHWAVCPSAEAQ
DPFSTLGPNAVLSPQRLVLETLSKLSIQDNNVDLILATPPFSRLEKLYST
MVRFLSDRKNPVCREMAVVLLANLAQGDSLAARAIAVQKGSIGNLLGFLE
DSLAATQFQQSQASLLHMQNPPFEPTSVDMMRRAARALLALAKVDENHSE
FTLYESRLLDISVSPLMNSLVSQVICDVLFLIGQS

Кодований геном білок за функціями належить до регуляторів хроматину, фосфопротеїнів. Задіяний у таких біологічних процесах як транскрипція, регуляція транскрипції, нейрогенез, поліморфізм, ацетиляція. Білок має сайт для зв'язування з ДНК. Локалізований у ядрі.

Література[ред. | ред. код]

  • Takeuchi T., Chen B.-K., Qiu Y., Sonobe H., Ohtsuki Y. (1997). Molecular cloning and expression of a novel human cDNA containing CAG repeats.. Gene 204: 71 — 77.  PubMed DOI:10.1016/S0378-1119(97)00525-8
  • Lemon B., Inouye C., King D.S., Tjian R. (2001). Selectivity of chromatin-remodelling cofactors for ligand-activated transcription.. Nature 414: 924 — 928.  PubMed DOI:10.1038/414924a
  • Beausoleil S.A., Villen J., Gerber S.A., Rush J., Gygi S.P. (2006). A probability-based approach for high-throughput protein phosphorylation analysis and site localization.. Nat. Biotechnol. 24: 1285 — 1292.  PubMed DOI:10.1038/nbt1240
  • Martens J.A., Winston F. (2003). Recent advances in understanding chromatin remodeling by SWI/SNF complexes.. Curr. Opin. Genet. Dev. 13: 136 — 142.  PubMed DOI:10.1016/S0959-437X(03)00022-4
  • Kim S., Zhang Z., Upchurch S., Isern N., Chen Y. (2004). Structure and DNA-binding sites of the SWI1 AT-rich interaction domain (ARID) suggest determinants for sequence-specific DNA recognition.. J. Biol. Chem. 279: 16670 — 16676.  PubMed DOI:10.1074/jbc.M312115200
  • Hurlstone A.F., Olave I.A., Barker N., van Noort M., Clevers H. (2002). Cloning and characterization of hELD/OSA1, a novel BRG1 interacting protein.. Biochem. J. 364: 255 — 264.  PubMed

Примітки[ред. | ред. код]

  1. Human PubMed Reference:. 
  2. Mouse PubMed Reference:. 
  3. HUGO Gene Nomenclature Commitee, HGNC:11110 (англ.). Процитовано 28 серпня 2017. 
  4. UniProt, O14497 (англ.). Процитовано 28 серпня 2017. 

Див. також[ред. | ред. код]