ARID2

Матеріал з Вікіпедії — вільної енциклопедії.
Перейти до навігації Перейти до пошуку
ARID2
Ідентифікатори
Символи ARID2, BAF200, p200, AT-rich interaction domain 2, CSS6
Зовнішні ІД OMIM: 609539 MGI: 1924294 HomoloGene: 14601 GeneCards: ARID2
Пов'язані генетичні захворювання
Coffin-Siris syndrome 6[1]
Шаблон експресії
PBB GE ARID2 gnf1h01783 at fs.png

PBB GE ARID2 gnf1h01782 at fs.png
Більше даних
Ортологи
Види Людина Миша
Entrez
Ensembl
UniProt
RefSeq (мРНК)
NM_152641
NM_001347839
NM_175251
RefSeq (білок)
NP_001334768
NP_689854
NP_780460
Локус (UCSC) Хр. 12: 45.73 – 45.91 Mb Хр. 15: 96.29 – 96.4 Mb
PubMed search [2] [3]
Вікідані
Див./Ред. для людейДив./Ред. для мишей

ARID2 (англ. AT-rich interaction domain 2) – білок, який кодується однойменним геном, розташованим у людей на короткому плечі 12-ї хромосоми.[4] Довжина поліпептидного ланцюга білка становить 1 835 амінокислот, а молекулярна маса — 197 391[5].

Послідовність амінокислот
1020304050
MANSTGKAPPDERRKGLAFLDELRQFHHSRGSPFKKIPAVGGKELDLHGL
YTRVTTLGGFAKVSEKNQWGEIVEEFNFPRSCSNAAFALKQYYLRYLEKY
EKVHHFGEDDDEVPPGNPKPQLPIGAIPSSYNYQQHSVSDYLRQSYGLSM
DFNSPNDYNKLVLSLLSGLPNEVDFAINVCTLLSNESKHVMQLEKDPKII
TLLLANAGVFDDTLGSFSTVFGEEWKEKTDRDFVKFWKDIVDDNEVRDLI
SDRNKSHEGTSGEWIWESLFHPPRKLGINDIEGQRVLQIAVILRNLSFEE
GNVKLLAANRTCLRFLLLSAHSHFISLRQLGLDTLGNIAAELLLDPVDFK
TTHLMFHTVTKCLMSRDRFLKMRGMEILGNLCKAEDNGVLICEYVDQDSY
REIICHLTLPDVLLVISTLEVLYMLTEMGDVACTKIAKVEKSIDMLVCLV
SMDIQMFGPDALAAVKLIEHPSSSHQMLSEIRPQAIEQVQTQTHVASAPA
SRAVVAQHVAPPPGIVEIDSEKFACQWLNAHFEVNPDCSVSRAEMYSEYL
STCSKLARGGILTSTGFYKCLRTVFPNHTVKRVEDSSSNGQAHIHVVGVK
RRAIPLPIQMYYQQQPVSTSVVRVDSVPDVSPAPSPAGIPHGSQTIGNHF
QRTPVANQSSNLTATQMSFPVQGVHTVAQTVSRIPQNPSPHTHQQQNAPV
TVIQSKAPIPCEVVKATVIQNSIPQTGVPVSIAVGGGPPQSSVVQNHSTG
PQPVTVVNSQTLLHHPSVIPQQSPLHTVVPGQIPSGTPVTVIQQAVPQSH
MFGRVQNIPACTSTVSQGQQLITTSPQPVQTSSQQTSAGSQSQDTVIIAP
PQYVTTSASNIVSATSVQNFQVATGQMVTIAGVPSPQASRVGFQNIAPKP
LPSQQVSSTVVQQPIQQPQQPTQQSVVIVSQPAQQGQTYAPAIHQIVLAN
PAALPAGQTVQLTGQPNITPSSSPSPVPATNNQVPTAMSSSSTPQSQGPP
PTVSQMLSVKRQQQQQHSPAPPPQQVQVQVQQPQQVQMQVQPQQSNAGVG
QPASGESSLIKQLLLPKRGPSTPGGKLILPAPQIPPPNNARAPSPQVVYQ
VASNQAAGFGVQGQTPAQQLLVGQQNVQLVPSAMPPSGGVQTVPISNLQI
LPGPLISNSPATIFQGTSGNQVTITVVPNTSFAPATVSQGNATQLIAPAG
ITMSGTQTGVGLPVQTLPATQASPAGQSSCTTATPPFKGDKIICQKEEEA
KEATGLHVHERKIEVMENPSCRRGATNTSNGDTKENEMHVGSLLNGRKYS
DSSLPPSNSGKIQSETNQCSLISNGPSLELGENGASGKQNSEQIDMQDIK
SDLRKPLVNGICDFDKGDGSHLSKNIPNHKTSNHVGNGEISPMEPQGTLD
ITQQDTAKGDQLERISNGPVLTLGGSSVSSIQEASNAATQQFSGTDLLNG
PLASSLNSDVPQQRPSVVVSPHSTTSVIQGHQIIAVPDSGSKVSHSPALS
SDVRSTNGTAECKTVKRPAEDTDRETVAGIPNKVGVRIVTISDPNNAGCS
ATMVAVPAGADPSTVAKVAIESAVQQKQQHPPTYVQNVVPQNTPMPPSPA
VQVQGQPNSSQPSPFSGSSQPGDPMRKPGQNFMCLWQSCKKWFQTPSQVF
YHAATEHGGKDVYPGQCLWEGCEPFQRQRFSFITHLQDKHCSKDALLAGL
KQDEPGQAGSQKSSTKQPTVGGTSSTPRAQKAIVNHPSAALMALRRGSRN
LVFRDFTDEKEGPITKHIRLTAALILKNIGKYSECGRRLLKRHENNLSVL
AISNMEASSTLAKCLYELNFTVQSKEQEKDSEMLQ

Кодований геном білок за функціями належить до регуляторів хроматину, фосфопротеїнів. Задіяний у таких біологічних процесах, як транскрипція, регуляція транскрипції, ацетилювання, альтернативний сплайсинг. Білок має сайт для зв'язування з іонами металів, іоном цинку, ДНК. Локалізований у ядрі.

Література[ред. | ред. код]

  • Zhang X., Azhar G., Zhong Y., Wei J.Y. (2006). Zipzap/p200 is a novel zinc finger protein contributing to cardiac gene regulation.. Biochem. Biophys. Res. Commun. 346: 794 — 801.  PubMed DOI:10.1016/j.bbrc.2006.05.211
  • Patsialou A., Wilsker D., Moran E. (2005). DNA-binding properties of ARID family proteins.. Nucleic Acids Res. 33: 66 — 80.  PubMed DOI:10.1093/nar/gki145
  • The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).. Genome Res. 14: 2121 — 2127. 2004.  PubMed DOI:10.1101/gr.2596504
  • Nagase T., Kikuno R., Nakayama M., Hirosawa M., Ohara O. (2000). Prediction of the coding sequences of unidentified human genes. XVIII. The complete sequences of 100 new cDNA clones from brain which code for large proteins in vitro.. DNA Res. 7: 273 — 281.  PubMed DOI:10.1093/dnares/7.4.271
  • Martens J.A., Winston F. (2003). Recent advances in understanding chromatin remodeling by SWI/SNF complexes.. Curr. Opin. Genet. Dev. 13: 136 — 142.  PubMed DOI:10.1016/S0959-437X(03)00022-4

Примітки[ред. | ред. код]

Див. також[ред. | ред. код]