ARNTL2

Матеріал з Вікіпедії — вільної енциклопедії.
Перейти до навігації Перейти до пошуку
ARNTL2
Наявні структури
PDBПошук ортологів: PDBe RCSB
Ідентифікатори
Символи ARNTL2, BMAL2, CLIF, MOP9, PASD9, bHLHe6, aryl hydrocarbon receptor nuclear translocator like 2
Зовнішні ІД OMIM: 614517 MGI: 2684845 HomoloGene: 10609 GeneCards: ARNTL2
Шаблон експресії
PBB GE ARNTL2 220658 s at fs.png
Більше даних
Ортологи
Види Людина Миша
Entrez
Ensembl
UniProt
RefSeq (мРНК)
NM_001248002
NM_001248003
NM_001248004
NM_001248005
NM_020183
NM_172309
NM_001289679
NM_001289680
NM_001289681
RefSeq (білок)
NP_001234931
NP_001234932
NP_001234933
NP_001234934
NP_064568
NP_001276608
NP_001276609
NP_001276610
NP_758513
Локус (UCSC) Хр. 12: 27.33 – 27.43 Mb Хр. 6: 146.8 – 146.83 Mb
PubMed search [1] [2]
Вікідані
Див./Ред. для людейДив./Ред. для мишей

ARNTL2 (англ. Aryl hydrocarbon receptor nuclear translocator like 2) – білок, який кодується однойменним геном, розташованим у людей на короткому плечі 12-ї хромосоми.[3] Довжина поліпептидного ланцюга білка становить 636 амінокислот, а молекулярна маса — 70 887[4].

Послідовність амінокислот
1020304050
MAAEEEAAAGGKVLREENQCIAPVVSSRVSPGTRPTAMGSFSSHMTEFPR
KRKGSDSDPSQSGIMTEKVVEKLSQNPLTYLLSTRIEISASSGSRVEDGE
HQVKMKAFREAHSQTEKRRRDKMNNLIEELSAMIPQCNPMARKLDKLTVL
RMAVQHLRSLKGLTNSYVGSNYRPSFLQDNELRHLILKTAEGFLFVVGCE
RGKILFVSKSVSKILNYDQASLTGQSLFDFLHPKDVAKVKEQLSSFDISP
REKLIDAKTGLQVHSNLHAGRTRVYSGSRRSFFCRIKSCKISVKEEHGCL
PNSKKKEHRKFYTIHCTGYLRSWPPNIVGMEEERNSKKDNSNFTCLVAIG
RLQPYIVPQNSGEINVKPTEFITRFAVNGKFVYVDQRATAILGYLPQELL
GTSCYEYFHQDDHNNLTDKHKAVLQSKEKILTDSYKFRAKDGSFVTLKSQ
WFSFTNPWTKELEYIVSVNTLVLGHSEPGEASFLPCSSQSSEESSRQSCM
SVPGMSTGTVLGAGSIGTDIANEILDLQRLQSSSYLDDSSPTGLMKDTHT
VNCRSMSNKELFPPSPSEMGELEATRQNQSTVAVHSHEPLLSDGAQLDFD
ALCDNDDTAMAAFMNYLEAEGGLGDPGDFSDIQWTL

Кодований геном білок за функцією належить до активаторів. Задіяний у таких біологічних процесах, як транскрипція, регуляція транскрипції, біологічні ритми, альтернативний сплайсинг. Білок має сайт для зв'язування з ДНК. Локалізований у ядрі.

Література[ред. | ред. код]

  • The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).. Genome Res. 14: 2121 — 2127. 2004.  PubMed DOI:10.1101/gr.2596504

Примітки[ред. | ред. код]

  1. Human PubMed Reference:. 
  2. Mouse PubMed Reference:. 
  3. HUGO Gene Nomenclature Commitee, HGNC:18984 (англ.). Процитовано 11 вересня 2017. 
  4. UniProt, Q8WYA1 (англ.). Процитовано 11 вересня 2017. 

Див. також[ред. | ред. код]