ATF1

Матеріал з Вікіпедії — вільної енциклопедії.
Перейти до навігації Перейти до пошуку
ATF1
Protein ATF1 PDB 1dh3.png
Ідентифікатори
Символи ATF1, EWS-FUS/ATF-1, TREB36, activating transcription factor 1
Зовнішні ІД OMIM: 123803 MGI: 3037720 HomoloGene: 3790 GeneCards: ATF1
Пов'язані генетичні захворювання
Angiomatoid fibrous histiocytoma[1]
Шаблон експресії
PBB GE ATF1 222103 at fs.png
Більше даних
Ортологи
Види Людина Миша
Entrez
Ensembl
UniProt
RefSeq (мРНК)
NM_005171
н/д
RefSeq (білок)
NP_005162
н/д
Локус (UCSC) Хр. 12: 50.76 – 50.82 Mb н/д
PubMed search [2] [3]
Вікідані
Див./Ред. для людейДив./Ред. для мишей

ATF1 (англ. Activating transcription factor 1) – білок, який кодується однойменним геном, розташованим у людей на короткому плечі 12-ї хромосоми.[4] Довжина поліпептидного ланцюга білка становить 271 амінокислот, а молекулярна маса — 29 233[5].

Послідовність амінокислот
1020304050
MEDSHKSTTSETAPQPGSAVQGAHISHIAQQVSSLSESEESQDSSDSIGS
SQKAHGILARRPSYRKILKDLSSEDTRGRKGDGENSGVSAAVTSMSVPTP
IYQTSSGQYIAIAPNGALQLASPGTDGVQGLQTLTMTNSGSTQQGTTILQ
YAQTSDGQQILVPSNQVVVQTASGDMQTYQIRTTPSATSLPQTVVMTSPV
TLTSQTTKTDDPQLKREIRLMKNREAARECRRKKKEYVKCLENRVAVLEN
QNKTLIEELKTLKDLYSNKSV

Кодований геном білок за функціями належить до активаторів, фосфопротеїнів. Задіяний у таких біологічних процесах, як транскрипція, регуляція транскрипції, альтернативний сплайсинг. Білок має сайт для зв'язування з ДНК. Локалізований у ядрі.

Література[ред. | ред. код]

  • The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).. Genome Res. 14: 2121 — 2127. 2004.  PubMed DOI:10.1101/gr.2596504
  • Hai T., Liu F., Coukos W.J., Green M.R. (1989). Transcription factor ATF cDNA clones: an extensive family of leucine zipper proteins able to selectively form DNA-binding heterodimers.. Genes Dev. 3: 2083 — 2090.  PubMed DOI:10.1101/gad.3.12b.2083
  • Waters B.L., Panagopoulos I., Allen E.F. (2000). Genetic characterization of angiomatoid fibrous histiocytoma identifies fusion of the FUS and ATF-1 genes induced by a chromosomal translocation involving bands 12q13 and 16p11.. Cancer Genet. Cytogenet. 121: 109 — 116.  PubMed DOI:10.1016/S0165-4608(00)00237-5
  • Sun P., Lou L., Maurer R.A. (1996). Regulation of activating transcription factor-1 and the cAMP response element-binding protein by Ca2+/calmodulin-dependent protein kinases type I, II, and IV.. J. Biol. Chem. 271: 3066 — 3073.  PubMed DOI:10.1074/jbc.271.6.3066
  • Hailemariam K., Iwasaki K., Huang B.W., Sakamoto K., Tsuji Y. (2010). Transcriptional regulation of ferritin and antioxidant genes by HIPK2 under genotoxic stress.. J. Cell Sci. 123: 3863 — 3871.  PubMed DOI:10.1242/jcs.073627
  • Yoshimura T., Fujisawa J., Yoshida M. (1990). Multiple cDNA clones encoding nuclear proteins that bind to the tax-dependent enhancer of HTLV-1: all contain a leucine zipper structure and basic amino acid domain.. EMBO J. 9: 2537 — 2542.  PubMed

Примітки[ред. | ред. код]

Див. також[ред. | ред. код]