AXIN1

Матеріал з Вікіпедії — вільної енциклопедії.
Перейти до навігації Перейти до пошуку
AXIN1
Protein AXIN1 PDB 1dk8.png
Наявні структури
PDBПошук ортологів: PDBe RCSB
Ідентифікатори
Символи AXIN1, AXIN, PPP1R49, axin 1
Зовнішні ІД OMIM: 603816 MGI: 1096327 HomoloGene: 2614 GeneCards: AXIN1
Пов'язані генетичні захворювання
Dipygus[1]
Шаблон експресії
PBB GE AXIN1 212849 at fs.png
Більше даних
Ортологи
Види Людина Миша
Entrez
Ensembl
UniProt
RefSeq (мРНК)
NM_003502
NM_181050
NM_001159598
NM_009733
RefSeq (білок)
NP_003493
NP_851393
NP_001153070
NP_033863
Локус (UCSC) Хр. 16: 0.29 – 0.35 Mb Хр. 17: 26.14 – 26.2 Mb
PubMed search [2] [3]
Вікідані
Див./Ред. для людейДив./Ред. для мишей

AXIN1 (англ. Axin 1) – білок, який кодується однойменним геном, розташованим у людей на короткому плечі 16-ї хромосоми.[4] Довжина поліпептидного ланцюга білка становить 862 амінокислот, а молекулярна маса — 95 635[5].

Послідовність амінокислот
1020304050
MNIQEQGFPLDLGASFTEDAPRPPVPGEEGELVSTDPRPASYSFCSGKGV
GIKGETSTATPRRSDLDLGYEPEGSASPTPPYLKWAESLHSLLDDQDGIS
LFRTFLKQEGCADLLDFWFACTGFRKLEPCDSNEEKRLKLARAIYRKYIL
DNNGIVSRQTKPATKSFIKGCIMKQLIDPAMFDQAQTEIQATMEENTYPS
FLKSDIYLEYTRTGSESPKVCSDQSSGSGTGKGISGYLPTLNEDEEWKCD
QDMDEDDGRDAAPPGRLPQKLLLETAAPRVSSSRRYSEGREFRYGSWREP
VNPYYVNAGYALAPATSANDSEQQSLSSDADTLSLTDSSVDGIPPYRIRK
QHRREMQESVQVNGRVPLPHIPRTYRVPKEVRVEPQKFAEELIHRLEAVQ
RTREAEEKLEERLKRVRMEEEGEDGDPSSGPPGPCHKLPPAPAWHHFPPR
CVDMGCAGLRDAHEENPESILDEHVQRVLRTPGRQSPGPGHRSPDSGHVA
KMPVALGGAASGHGKHVPKSGAKLDAAGLHHHRHVHHHVHHSTARPKEQV
EAEATRRAQSSFAWGLEPHSHGARSRGYSESVGAAPNASDGLAHSGKVGV
ACKRNAKKAESGKSASTEVPGASEDAEKNQKIMQWIIEGEKEISRHRRTG
HGSSGTRKPQPHENSRPLSLEHPWAGPQLRTSVQPSHLFIQDPTMPPHPA
PNPLTQLEEARRRLEEEEKRASRAPSKQRYVQEVMRRGRACVRPACAPVL
HVVPAVSDMELSETETRSQRKVGGGSAQPCDSIVVAYYFCGEPIPYRTLV
RGRAVTLGQFKELLTKKGSYRYYFKKVSDEFDCGVVFEEVREDEAVLPVF
EEKIIGKVEKVD

Кодований геном білок за функціями належить до білків розвитку, фосфопротеїнів. Задіяний у таких біологічних процесах, як апоптоз, сигнальний шлях Wnt, альтернативний сплайсинг. Локалізований у клітинній мембрані, цитоплазмі, ядрі, мембрані.

Література[ред. | ред. код]

  • The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).. Genome Res. 14: 2121 — 2127. 2004.  PubMed DOI:10.1101/gr.2596504
  • Hsu W., Zeng L., Costantini F. (1999). Identification of a domain of Axin that binds to the serine/threonine protein phosphatase 2A and a self-binding domain.. J. Biol. Chem. 274: 3439 — 3445.  PubMed DOI:10.1074/jbc.274.6.3439
  • Kusano S., Raab-Traub N. (2002). I-mfa domain proteins interact with Axin and affect its regulation of the Wnt and c-Jun N-terminal kinase signaling pathways.. Mol. Cell. Biol. 22: 6393 — 6405.  PubMed DOI:10.1128/MCB.22.18.6393-6405.2002
  • Howe P.H. (2003). Regulation of the Wnt signaling pathway by disabled-2 (Dab2).. EMBO J. 22: 3084 — 3094.  PubMed DOI:10.1093/emboj/cdg286
  • Kim M.J., Chia I.V., Costantini F. (2008). SUMOylation target sites at the C terminus protect Axin from ubiquitination and confer protein stability.. FASEB J. 22: 3785 — 3794.  PubMed DOI:10.1096/fj.08-113910
  • Spink K.E., Polakis P., Weis W.I. (2000). Structural basis of the axin-adenomatous polyposis coli interaction.. EMBO J. 19: 2270 — 2279.  PubMed DOI:10.1093/emboj/19.10.2270

Примітки[ред. | ред. код]

Див. також[ред. | ред. код]