BCL7B

Матеріал з Вікіпедії — вільної енциклопедії.
Перейти до навігації Перейти до пошуку
BCL7B
Ідентифікатори
Символи BCL7B, BCL tumor suppressor 7B, BAF complex component, BAF chromatin remodeling complex subunit BCL7B
Зовнішні ІД OMIM: 605846 MGI: 1332238 HomoloGene: 1290 GeneCards: BCL7B
Ортологи
Види Людина Миша
Entrez
Ensembl
UniProt
RefSeq (мРНК)
NM_001197244
NM_001301061
NM_001707
NM_138707
NM_009745
RefSeq (білок)
NP_001184173
NP_001287990
NP_001698
NP_033875
Локус (UCSC) Хр. 7: 73.54 – 73.56 Mb Хр. 5: 135.17 – 135.18 Mb
PubMed search [1] [2]
Вікідані
Див./Ред. для людейДив./Ред. для мишей

BCL7B (англ. BCL tumor suppressor 7B) – білок, який кодується однойменним геном, розташованим у людей на 7-ї хромосомі.[3] Довжина поліпептидного ланцюга білка становить 202 амінокислот, а молекулярна маса — 22 195[4].

Послідовність амінокислот
1020304050
MSGRSVRAETRSRAKDDIKKVMAAIEKVRKWEKKWVTVGDTSLRIFKWVP
VTDSKEKEKSKSNSSAAREPNGFPSDASANSSLLLEFQDENSNQSSVSDV
YQLKVDSSTNSSPSPQQSESLSPAHTSDFRTDDSQPPTLGQEILEEPSLP
SSEVADEPPTLTKEEPVPLETQVVEEEEDSGAPPLKRFCVDQPTVPQTAS
ES

Кодований геном білок за функцією належить до фосфопротеїнів. Задіяний у таких біологічних процесах, як апоптоз, диференціація клітин, сигнальний шлях Wnt, альтернативний сплайсинг.

Література[ред. | ред. код]

  • The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).. Genome Res. 14: 2121 — 2127. 2004.  PubMed DOI:10.1101/gr.2596504
  • Uehara T., Kage-Nakadai E., Yoshina S., Imae R., Mitani S. (2015). The tumor suppressor BCL7B functions in the Wnt signaling pathway.. PLoS Genet. 11: E1004921 — E1004921.  PubMed DOI:10.1371/journal.pgen.1004921

Примітки[ред. | ред. код]

  1. Human PubMed Reference:. 
  2. Mouse PubMed Reference:. 
  3. HUGO Gene Nomenclature Commitee, HGNC:1005 (англ.). Процитовано 19 вересня 2017. 
  4. UniProt, Q9BQE9 (англ.). Процитовано 19 вересня 2017. 

Див. також[ред. | ред. код]